Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23050 92 / 3e-22 PAS domain-containing protein tyrosine kinase family protein (.1.2) AT5G49470 76 / 1e-16 PAS domain-containing protein tyrosine kinase family protein (.1.2.3.4) AT3G06620 74 / 5e-16 PAS domain-containing protein tyrosine kinase family protein (.1) AT1G08720 74 / 6e-16 EDR1, ATEDR1 ENHANCED DISEASE RESISTANCE 1, Protein kinase superfamily protein (.1) AT1G18160 73 / 1e-15 Protein kinase superfamily protein (.1) AT1G67890 72 / 3e-15 PAS domain-containing protein tyrosine kinase family protein (.1.2) AT5G11850 71 / 1e-14 Protein kinase superfamily protein (.1) AT3G06640 71 / 1e-14 PAS domain-containing protein tyrosine kinase family protein (.1) AT1G73660 70 / 1e-14 protein tyrosine kinase family protein (.1) AT5G03730 69 / 4e-14 AtCTR1, SIS1, CTR1 SUGAR-INSENSITIVE 1, CONSTITUTIVE TRIPLE RESPONSE 1, Protein kinase superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G122700 [exp] 108 / 5e-28 AT4G23050 606 / 0.0 PAS domain-containing protein tyrosine kinase family protein (.1.2) Potri.010G146000 [exp] 77 / 5e-17 AT3G06620 953 / 0.0 PAS domain-containing protein tyrosine kinase family protein (.1) Potri.008G105100 [exp] 77 / 7e-17 AT5G49470 948 / 0.0 PAS domain-containing protein tyrosine kinase family protein (.1.2.3.4) Potri.013G034800 [exp] 75 / 4e-16 AT1G08720 972 / 0.0 ENHANCED DISEASE RESISTANCE 1, Protein kinase superfamily protein (.1) Potri.005G047600 [exp] 74 / 9e-16 AT1G08720 972 / 0.0 ENHANCED DISEASE RESISTANCE 1, Protein kinase superfamily protein (.1) Potri.015G040100 [exp] 72 / 4e-15 AT1G73660 593 / 0.0 protein tyrosine kinase family protein (.1) Potri.018G053800 [exp] 71 / 7e-15 AT5G11850 517 / 2e-169 Protein kinase superfamily protein (.1) Potri.006G229400 [exp] 71 / 1e-14 AT5G11850 520 / 2e-170 Protein kinase superfamily protein (.1) Potri.006G115800 [exp] 69 / 2e-14 AT5G03730 957 / 0.0 SUGAR-INSENSITIVE 1, CONSTITUTIVE TRIPLE RESPONSE 1, Protein kinase superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024502 [exp] 100 / 5e-25 AT4G23050 579 / 0.0 PAS domain-containing protein tyrosine kinase family protein (.1.2) Lus10017844 [exp] 100 / 6e-25 AT4G23050 520 / 4e-175 PAS domain-containing protein tyrosine kinase family protein (.1.2) Lus10037772 [exp] 79 / 2e-17 AT3G06620 919 / 0.0 PAS domain-containing protein tyrosine kinase family protein (.1) Lus10016912 [exp] 79 / 2e-17 AT1G67890 848 / 0.0 PAS domain-containing protein tyrosine kinase family protein (.1.2) Lus10000937 [exp] 77 / 7e-17 AT1G08720 917 / 0.0 ENHANCED DISEASE RESISTANCE 1, Protein kinase superfamily protein (.1) Lus10004124 [exp] 77 / 7e-17 AT1G08720 948 / 0.0 ENHANCED DISEASE RESISTANCE 1, Protein kinase superfamily protein (.1) Lus10040540 [exp] 74 / 7e-16 AT3G06620 858 / 0.0 PAS domain-containing protein tyrosine kinase family protein (.1) Lus10027247 [exp] 72 / 5e-15 AT1G18160 987 / 0.0 Protein kinase superfamily protein (.1) Lus10031341 [exp] 69 / 4e-14 AT1G73660 682 / 0.0 protein tyrosine kinase family protein (.1) Lus10009062 [exp] 66 / 3e-13 AT1G73660 673 / 0.0 protein tyrosine kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.001G108900.2 pacid=42790669 polypeptide=Potri.001G108900.2.p locus=Potri.001G108900 ID=Potri.001G108900.2.v4.1 annot-version=v4.1 ATGAAACCGAACCCTGTTATTCTACAAATGGACAAGTGCTGCTTTTCTTCTTTCATGCTAAACAGATTCAATAGAATTGCTTGCTTGCCAAGAGTGGAGG TGACACGGTCCCTCTTTCATCATCTAGCATTCTTAACTCTTGATGTCCTGGACAACTGTCACCTTGTTTCTAGCTCAGAGATCAACGATGTTCAAGCAGA AATCATTAAACCTGATTATCAGCCGAGGTCTGATGTGTTTGGTTTCGGTGTCATCCTATGGGAACCAATGACTGTCCCCATTCCATGGATCAAGTTAGAT TCCTTAGAGGTAGCTGGAGTTGTAGGCTTCATGGATAGAAGATTGGTTTTACCAGAAAGCCTTGATCCCATGGTAGCAACTATTATCAGCGATTGTTGGC GAAGTTATACAAGCAGCGATCCTGAAGAACGTCCATTTCGAGGAGATAATTCAACGAATGACTAG
AA sequence Show only first row Show all	>Potri.001G108900.2 pacid=42790669 polypeptide=Potri.001G108900.2.p locus=Potri.001G108900 ID=Potri.001G108900.2.v4.1 annot-version=v4.1 MKPNPVILQMDKCCFSSFMLNRFNRIACLPRVEVTRSLFHHLAFLTLDVLDNCHLVSSSEINDVQAEIIKPDYQPRSDVFGFGVILWEPMTVPIPWIKLD SLEVAGVVGFMDRRLVLPESLDPMVATIISDCWRSYTSSDPEERPFRGDNSTND

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G23050			PAS domain-containing protein ...		Potri.001G108900 [exp]	0	1
AT1G15950		IRX4, ATCCR1, C...	IRREGULAR XYLEM 4, cinnamoyl c...		Potri.001G045600 [exp]	2.00	0.9816
AT4G21390		B120	S-locus lectin protein kinase ...		Potri.011G037600 [exp]	4.24	0.9753
AT3G12360		ITN1	INCREASED TOLERANCE TO NACL, A...		Potri.006G214500 [exp]	4.47	0.9695
					Potri.001G045901 [exp]	5.74	0.9606
					Potri.001G045301 [exp]	6.00	0.9732
AT4G21390		B120	S-locus lectin protein kinase ...		Potri.011G037300 [exp]	7.74	0.9692
AT2G01340		At17.1	unknown protein		Potri.008G128700 [exp]	10.09	0.9146
AT5G25880		ATNADP-ME3	Arabidopsis thaliana NADP-mali...		Potri.006G236500 [exp]	13.26	0.9654
AT2G27660			Cysteine/Histidine-rich C1 dom...		Potri.001G229500 [exp]	14.59	0.9389
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Potri.018G149300 [exp]	17.66	0.9136	CYP716.1

Compare expression of checked genes

Potri.001G108900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.