Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47960 46 / 2e-06 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1) AT3G17150 45 / 5e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G64620 42 / 7e-05 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G122000 [exp] 267 / 2e-92 AT5G64620 53 / 7e-09 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.006G134900 [exp] 55 / 2e-09 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.009G083500 [exp] 53 / 8e-09 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.003G086600 [exp] 52 / 2e-08 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.010G063000 [exp] 51 / 4e-08 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.001G127500 [exp] 50 / 6e-08 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.008G102600 [exp] 47 / 1e-06 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.014G044100 [exp] 43 / 3e-05 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.007G108301 [exp] 42 / 8e-05 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000822 [exp] 59 / 6e-11 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017040 [exp] 47 / 9e-07 AT1G47960 92 / 3e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10037793 [exp] 46 / 3e-06 AT3G17152 74 / 5e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10017077 [exp] 45 / 6e-06 AT3G17152 76 / 1e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10016319 [exp] 43 / 4e-05 AT3G17130 151 / 8e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10016318 [exp] 42 / 6e-05 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10002739 [exp] 40 / 0.0003 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10043346 [exp] 39 / 0.0005 AT5G46940 69 / 3e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10017076 [exp] 39 / 0.001 AT1G47960 88 / 9e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.001G109700.1 pacid=42791928 polypeptide=Potri.001G109700.1.p locus=Potri.001G109700 ID=Potri.001G109700.1.v4.1 annot-version=v4.1 ATGAGCTCTTCTTTATTCCTCACACTCCTACTAATTCTCATCTCAGCAAGCCAAGGTTGTGCAGCAGTGCCGGAGAAAGAACCTGATCTAATACAGAAAT CCTGCGCAATAATCGTAGGTTATGAAGAATGCGTGGCAATTCTCAGATCAGACCCTCGTTCCATTAAAGCTACCAAAGTCAAACAGCTAGCCTACATCAT TCTTGATCTCTGCATAGAAAATGCCACAGAGACTCTTGGAGAAATCCCGAAGTTGCAGGAGAAGTACTCAAAGCATGACCAAATTGAGGAAGCTCTAAGG TGGTGTGTCATGGCATATGAGAGTGCTATCAAAGATTACTTTCGCAAAGCTGTTGACCAGCTGGGTACAAAGTCTTATCGTGAAGCACAGTATTCAGCAC ACATTGGAGGTGCGTTAGGTACGGGTTGTGAACAAGAATTTTATTTCCAAGCACCAGTAATTTCACCTTTATGGCCCAGGAATCATAATTTGGCAGTTCT TGGTCTTGTAGCAGAAGGCATCGTTTCCCTTCTTCGTCTGAATGAGTCTCAACTGTAA
AA sequence Show only first row Show all	>Potri.001G109700.1 pacid=42791928 polypeptide=Potri.001G109700.1.p locus=Potri.001G109700 ID=Potri.001G109700.1.v4.1 annot-version=v4.1 MSSSLFLTLLLILISASQGCAAVPEKEPDLIQKSCAIIVGYEECVAILRSDPRSIKATKVKQLAYIILDLCIENATETLGEIPKLQEKYSKHDQIEEALR WCVMAYESAIKDYFRKAVDQLGTKSYREAQYSAHIGGALGTGCEQEFYFQAPVISPLWPRNHNLAVLGLVAEGIVSLLRLNESQL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Potri.001G109700 [exp]	0	1
AT1G34640			peptidases (.1)		Potri.002G096700 [exp]	1.73	0.9949
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Potri.019G094000 [exp]	3.00	0.9936
AT1G14430			glyoxal oxidase-related protei...		Potri.001G083600 [exp]	4.00	0.9948
AT5G18080		SAUR24	small auxin up RNA 24, SAUR-li...		Potri.004G165400 [exp]	4.24	0.9883
AT5G18060			SAUR-like auxin-responsive pro...		Potri.009G126300 [exp]	4.89	0.9918
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Potri.013G115900 [exp]	4.89	0.9901
AT4G24340			Phosphorylase superfamily prot...		Potri.013G082700 [exp]	6.00	0.9872
AT2G01505		CLE16	CLAVATA3/ESR-RELATED 16 (.1)		Potri.010G111200 [exp]	6.48	0.9862
AT5G39240			unknown protein		Potri.004G119600 [exp]	7.74	0.9909
AT5G54010			UDP-Glycosyltransferase superf...		Potri.006G179700 [exp]	10.58	0.9886

Compare expression of checked genes

Potri.001G109700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.