Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59810 74 / 1e-16 ATSBT5.4 Subtilase family protein (.1) AT5G59120 69 / 6e-15 ATSBT4.13 subtilase 4.13 (.1) AT5G58820 69 / 1e-14 Subtilisin-like serine endopeptidase family protein (.1) AT5G58840 67 / 4e-14 Subtilase family protein (.1) AT5G58830 67 / 6e-14 Subtilisin-like serine endopeptidase family protein (.1) AT5G59090 66 / 1e-13 ATSBT4.12 subtilase 4.12 (.1.2.3) AT2G05920 66 / 1e-13 Subtilase family protein (.1) AT5G59190 63 / 8e-13 subtilase family protein (.1) AT5G67090 63 / 1e-12 Subtilisin-like serine endopeptidase family protein (.1) AT5G59100 63 / 1e-12 Subtilisin-like serine endopeptidase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G118700 [exp] 144 / 3e-41 AT1G04110 585 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.001G113700 [exp] 106 / 5e-28 AT1G04110 538 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.019G006570 [exp] 101 / 3e-26 AT1G04110 568 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.003G118500 [exp] 94 / 1e-23 AT1G04110 557 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.003G118800 [exp] 94 / 1e-23 AT1G04110 585 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.011G165900 [exp] 74 / 1e-16 AT2G04160 882 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.014G074600 [exp] 74 / 2e-16 AT1G01900 788 / 0.0 subtilase family protein (.1) Potri.001G468800 [exp] 71 / 1e-15 AT5G59810 939 / 0.0 Subtilase family protein (.1) Potri.007G045100 [exp] 70 / 4e-15 AT5G67090 727 / 0.0 Subtilisin-like serine endopeptidase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007044 [exp] 97 / 2e-24 AT1G04110 590 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Lus10007045 [exp] 96 / 2e-24 AT1G04110 603 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Lus10028893 [exp] 94 / 3e-23 AT1G04110 580 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Lus10002242 [exp] 89 / 9e-22 AT5G67360 555 / 0.0 Subtilase family protein (.1) Lus10002995 [exp] 89 / 1e-21 AT1G04110 584 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Lus10029575 [exp] 87 / 7e-21 AT5G67360 552 / 0.0 Subtilase family protein (.1) Lus10029570 [exp] 87 / 7e-21 AT5G67360 550 / 0.0 Subtilase family protein (.1) Lus10007036 [exp] 84 / 5e-20 AT5G67360 564 / 0.0 Subtilase family protein (.1) Lus10029568 [exp] 84 / 5e-20 AT5G67360 166 / 1e-44 Subtilase family protein (.1) Lus10006693 [exp] 84 / 6e-20 AT5G67360 563 / 0.0 Subtilase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G113566.1 pacid=42790097 polypeptide=Potri.001G113566.1.p locus=Potri.001G113566 ID=Potri.001G113566.1.v4.1 annot-version=v4.1 ATGGATTTTTGTCACAAAGCCCCAAAAATACCGTCTTCTCTACATACACCTCACAGTCCAAACTTCTTGGCGTTGCAAAAAATTTTGGAGAAACTCGACT TATGGAATAGGAATGATTATTGGGGTTCTTCATTCACTGATGAAAAAGTTCCGCGTCCACCAGCCAAATGGAAAGGTAAATGTAATTTCAATGGAACCGT GTGTAACAACAAACTCATTGGTGCAAGAGATTCCATTTCATCAAAAGCGGCACCATCATTTGATGATGAAGGCCATGGGACTCACACGGCCAGCACAGCA GCTGGAAATTTTGTAAATGACGCCAATGTTAGGCAACGCTAA
AA sequence Show only first row Show all	>Potri.001G113566.1 pacid=42790097 polypeptide=Potri.001G113566.1.p locus=Potri.001G113566 ID=Potri.001G113566.1.v4.1 annot-version=v4.1 MDFCHKAPKIPSSLHTPHSPNFLALQKILEKLDLWNRNDYWGSSFTDEKVPRPPAKWKGKCNFNGTVCNNKLIGARDSISSKAAPSFDDEGHGTHTASTA AGNFVNDANVRQR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Potri.001G113566 [exp]	0	1
AT4G24190		AtHsp90-7, HSP9...	SHEPHERD, HEAT SHOCK PROTEIN 9...		Potri.005G241100 [exp]	6.55	0.7092
AT4G16660			heat shock protein 70 (Hsp 70)...		Potri.006G022100 [exp]	12.72	0.7040
AT4G28290			unknown protein		Potri.001G449633 [exp]	18.70	0.7085
AT4G10040		CYTC-2	cytochrome c-2 (.1)		Potri.013G101601 [exp]	20.12	0.6865
					Potri.001G400401 [exp]	30.39	0.6817
AT1G09157			Protein of unknown function (D...		Potri.010G168400 [exp]	44.18	0.6282
AT4G16660			heat shock protein 70 (Hsp 70)...		Potri.016G019800 [exp]	46.15	0.6710
AT5G42020		BIP2, BIP	luminal binding protein, Heat ...		Potri.003G143600 [exp]	54.74	0.6240	BIP.1
AT3G02970		EXL6	EXORDIUM like 6 (.1)		Potri.013G080100 [exp]	67.40	0.6494
AT5G03160		ATP58IPK	homolog of mamallian P58IPK (....		Potri.016G088600 [exp]	79.64	0.6306

Compare expression of checked genes

Potri.001G113566 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.