Potri.001G114900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G60890 56 / 2e-11 ZPR2 LITTLE ZIPPER 2, protein binding (.1.2)
AT2G45450 38 / 0.0002 ZPR1 LITTLE ZIPPER 1, protein binding (.1)
AT3G52770 37 / 0.0002 ZPR3 LITTLE ZIPPER 3, protein binding (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G117200 161 / 4e-53 AT3G60890 63 / 4e-14 LITTLE ZIPPER 2, protein binding (.1.2)
Potri.014G071200 59 / 1e-12 AT3G60890 62 / 1e-13 LITTLE ZIPPER 2, protein binding (.1.2)
Potri.002G149600 57 / 2e-11 AT3G60890 65 / 1e-14 LITTLE ZIPPER 2, protein binding (.1.2)
Potri.006G083201 47 / 2e-07 AT3G52770 54 / 2e-10 LITTLE ZIPPER 3, protein binding (.1)
Potri.010G237600 39 / 3e-05 AT3G52770 49 / 7e-10 LITTLE ZIPPER 3, protein binding (.1)
Potri.008G021766 37 / 0.0003 AT3G52770 51 / 1e-10 LITTLE ZIPPER 3, protein binding (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028902 90 / 2e-24 AT3G60890 59 / 1e-12 LITTLE ZIPPER 2, protein binding (.1.2)
Lus10008913 84 / 3e-22 AT3G60890 58 / 2e-12 LITTLE ZIPPER 2, protein binding (.1.2)
Lus10006673 73 / 6e-18 AT3G60890 47 / 4e-08 LITTLE ZIPPER 2, protein binding (.1.2)
Lus10007017 61 / 4e-13 AT3G60890 48 / 3e-08 LITTLE ZIPPER 2, protein binding (.1.2)
Lus10021375 45 / 3e-07 AT3G52770 77 / 3e-20 LITTLE ZIPPER 3, protein binding (.1)
Lus10017055 45 / 4e-07 AT3G52770 77 / 5e-20 LITTLE ZIPPER 3, protein binding (.1)
Lus10022725 43 / 1e-06 AT3G52770 73 / 5e-19 LITTLE ZIPPER 3, protein binding (.1)
Lus10014188 42 / 3e-06 AT3G52770 72 / 1e-18 LITTLE ZIPPER 3, protein binding (.1)
PFAM info
Representative CDS sequence
>Potri.001G114900.1 pacid=42788341 polypeptide=Potri.001G114900.1.p locus=Potri.001G114900 ID=Potri.001G114900.1.v4.1 annot-version=v4.1
ATGTGCACTAACGGAGTAGAGAGGTTCCCTTCTCCTTTCCACCCTTCAAAAAGAAGGCAAAGATCAAAGAAATGTAAGGTTCAAGTTATTGGGCTCACCT
GCAGGAGGTCAGGATATGAAGAAATGGAGGGGAAGGACATGGAGCTAAAGAACTTGAAGTTGTGTTTAGAGAACCAAAGAATCGTTGAAGAGAACGAGAA
GCTGAGGAAGAAAGCTAATCTTCTCCGCCAAGAAAACTTGGCCTTAATGTCTGAATTTCAAAAGAAATTCCCTCATTTGGATCGCTTATCCACCACCCTA
CTTCTTTTACACAACACTAGCAAAATGTAA
AA sequence
>Potri.001G114900.1 pacid=42788341 polypeptide=Potri.001G114900.1.p locus=Potri.001G114900 ID=Potri.001G114900.1.v4.1 annot-version=v4.1
MCTNGVERFPSPFHPSKRRQRSKKCKVQVIGLTCRRSGYEEMEGKDMELKNLKLCLENQRIVEENEKLRKKANLLRQENLALMSEFQKKFPHLDRLSTTL
LLLHNTSKM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G60890 ZPR2 LITTLE ZIPPER 2, protein bindi... Potri.001G114900 0 1
AT5G67210 IRX15-L IRX15-LIKE, Protein of unknown... Potri.001G302600 1.73 0.8047
AT4G10550 Subtilase family protein (.1.2... Potri.001G455800 4.00 0.7875
AT3G50530 CRK CDPK-related kinase (.1.2) Potri.007G040800 5.47 0.7552
Potri.001G135100 5.65 0.7933
AT1G63930 ROH1 from the Czech 'roh' meaning '... Potri.001G099700 6.00 0.7381
AT5G52870 MAKR5 MEMBRANE-ASSOCIATED KINASE REG... Potri.015G027500 6.48 0.7467
AT4G32570 ZIM TIFY8 TIFY domain protein 8 (.1) Potri.006G247500 6.70 0.7277
AT1G52150 HD ATHB15, ICU4, C... INCURVATA 4, CORONA, Homeobox-... Potri.003G050100 13.60 0.7760 ATHB.11
AT2G31280 bHLH bHLH155 ,CPuORF... conserved peptide upstream ope... Potri.002G040600 18.43 0.6988
AT1G49890 QWRF2 QWRF domain containing 2, Fami... Potri.014G017500 20.49 0.7933

Potri.001G114900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.