Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	CLPR2.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G12410 408 / 3e-145 EMB3146, CLP2, NCLPP2, CLPR2 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) ATCG00670 174 / 5e-54 PCLPP, ATCG00670.1, CLPP1 CASEINOLYTIC PROTEASE P 1, plastid-encoded CLP P (.1) AT1G02560 142 / 2e-40 NCLPP5, NCLPP1, CLPP5 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) AT5G23140 134 / 7e-38 NCLPP7, NCLPP2, CLPP2 nuclear-encoded CLP protease P7 (.1) AT5G45390 130 / 5e-36 NCLPP3, NCLPP4, CLPP4 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) AT1G11750 125 / 2e-34 NCLPP6, NCLPP1, CLPP6 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) AT4G17040 124 / 1e-33 HON5, CLPR4 happy on norflurazon 5, CLP protease R subunit 4 (.1) AT1G66670 124 / 2e-33 NCLPP3, NCLPP4, CLPP3 CLP protease proteolytic subunit 3 (.1) AT1G09130 95 / 2e-22 ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.1), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.2), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.3) AT1G49970 89 / 4e-20 SVR2, NCLPP5, CLPR1 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G195200 [exp] 140 / 6e-40 AT1G02560 474 / 2e-170 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.014G119700 [exp] 140 / 6e-40 AT1G02560 493 / 6e-178 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.007G071700 [exp] 139 / 2e-39 AT5G23140 383 / 1e-135 nuclear-encoded CLP protease P7 (.1) Potri.005G092600 [exp] 136 / 9e-39 AT5G23140 380 / 3e-135 nuclear-encoded CLP protease P7 (.1) Potri.004G152900 [exp] 132 / 6e-37 AT1G11750 397 / 4e-141 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.009G114001 [exp] 128 / 2e-35 AT1G11750 353 / 2e-123 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.004G092100 [exp] 129 / 4e-35 AT1G66670 441 / 2e-156 CLP protease proteolytic subunit 3 (.1) Potri.003G103300 [exp] 127 / 1e-34 AT5G45390 383 / 9e-135 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Potri.003G083300 [exp] 125 / 6e-34 AT4G17040 441 / 2e-157 happy on norflurazon 5, CLP protease R subunit 4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028905 [exp] 284 / 4e-96 AT1G12410 268 / 5e-90 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) Lus10004319 [exp] 238 / 1e-78 AT1G12410 239 / 7e-79 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) Lus10017397 [exp] 140 / 2e-40 AT5G23140 394 / 1e-140 nuclear-encoded CLP protease P7 (.1) Lus10010196 [exp] 139 / 9e-40 AT5G23140 395 / 4e-141 nuclear-encoded CLP protease P7 (.1) Lus10040982 [exp] 138 / 7e-39 AT5G23140 338 / 5e-118 nuclear-encoded CLP protease P7 (.1) Lus10002422 [exp] 135 / 1e-37 AT1G02560 361 / 4e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10013434 [exp] 134 / 2e-37 AT5G23140 347 / 3e-121 nuclear-encoded CLP protease P7 (.1) Lus10040981 [exp] 133 / 4e-37 AT5G23140 350 / 1e-122 nuclear-encoded CLP protease P7 (.1) Lus10001450 [exp] 134 / 8e-37 AT1G02560 365 / 1e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10025022 [exp] 132 / 1e-36 AT1G02560 313 / 3e-107 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0127 [poplar] [flax] ClpP_crotonase PF00574 [poplar] [flax] CLP_protease Clp protease
Representative CDS sequence Show only first row Show all	>Potri.001G115900.2 pacid=42790609 polypeptide=Potri.001G115900.2.p locus=Potri.001G115900 ID=Potri.001G115900.2.v4.1 annot-version=v4.1 ATGGCATCCTCTCTTAATGCGAACCTCAGTCAGCCTTCTCTCAGTTGCGGAGCCAAACTTTATTCAGGATTGAAGCTTCAATTTCCAAGTCTGTATGCAA CTGGGAGACCTAATTTAACTGCAGAGTTTTATGGAAAGGTTAATAAGAGCCTTCAATGCGGGACTCGTAATCATAAACCAACACGGGCAGCAGTTAAAAT GATGCCTATAGGGACTCCCAGGGTGCCCTATAGAACTCCTGGGGAGGGAACCTGGCAATGGGTTGATATATGGAATGCCCTATATCGAGAGCGTATTCTC TTCATTGGACAAAATATAGACGAAGAGTTTAGCAACCAAATATTGGCCACAATGTTATACCTTGACACAATTGATGATTCCAAAAGGATGTATTTATATA TCAATGGTCCTGGTGGAGATCTTACTCCAAGCTTGGCCATATATGACACTATGCAGAGCTTGAAGAGTCCTGTTGGTACCCACTGTGTGGGATTTGCCTA TAACCTAGCAGGCTTTCTTCTTACAGCTGGGGAAAAGGGAAATCGCTCTGCAATGCCTCTTTCAAGAATTGCTCTACAATCACCAGCTGGGGCTGCTCGG GGTCAGGCTGATGACATTTGTAATGAAGCAAATGAGCTTCTTAGAATCAGGGACTATCTTTACAATGAGTTATCTAAGAAAACAGGACAGCCTTTTGAAA AGATTAGCAAAGACTTGAGCAGAATGAAGCGCTTTGAAGCCCAAGATGCCCTTGAGTATGGTCTCATTGATCGCATAATCAGGCCACCCCGAATAGATGA TGATGTAGGTCCCAGTGATGCATCAGCAGGTCTTGGTTAG
AA sequence Show only first row Show all	>Potri.001G115900.2 pacid=42790609 polypeptide=Potri.001G115900.2.p locus=Potri.001G115900 ID=Potri.001G115900.2.v4.1 annot-version=v4.1 MASSLNANLSQPSLSCGAKLYSGLKLQFPSLYATGRPNLTAEFYGKVNKSLQCGTRNHKPTRAAVKMMPIGTPRVPYRTPGEGTWQWVDIWNALYRERIL FIGQNIDEEFSNQILATMLYLDTIDDSKRMYLYINGPGGDLTPSLAIYDTMQSLKSPVGTHCVGFAYNLAGFLLTAGEKGNRSAMPLSRIALQSPAGAAR GQADDICNEANELLRIRDYLYNELSKKTGQPFEKISKDLSRMKRFEAQDALEYGLIDRIIRPPRIDDDVGPSDASAGLG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G12410		EMB3146, CLP2, ...	NUCLEAR-ENCODED CLP PROTEASE P...		Potri.001G115900 [exp]	0	1	CLPR2.1
AT2G27290			Protein of unknown function (D...		Potri.009G161800 [exp]	1.41	0.9728
AT3G19810			Protein of unknown function (D...		Potri.010G170100 [exp]	2.00	0.9733
AT2G41950			unknown protein		Potri.006G194600 [exp]	2.44	0.9727
AT2G32480		ARASP	ARABIDOPSIS SERIN PROTEASE (.1...		Potri.002G228600 [exp]	8.48	0.9584
AT5G39210		CRR7	chlororespiratory reduction 7 ...		Potri.004G120300 [exp]	9.59	0.9717
AT4G09650		PDE332, ATPD	PIGMENT DEFECTIVE 332, ATP syn...		Potri.014G102100 [exp]	11.74	0.9679
AT2G15290		ATTIC21, TIC21,...	PERMEASE IN CHLOROPLASTS 1, CH...		Potri.001G300500 [exp]	12.32	0.9445
AT3G47650			DnaJ/Hsp40 cysteine-rich domai...		Potri.018G028500 [exp]	12.40	0.9572
AT5G23850			Arabidopsis thaliana protein o...		Potri.002G157800 [exp]	12.40	0.9443
AT2G41120			unknown protein		Potri.006G025200 [exp]	13.41	0.9638

Compare expression of checked genes

Potri.001G115900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.