Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G12390 184 / 3e-61 Cornichon family protein (.1) AT1G12340 183 / 9e-61 Cornichon family protein (.1) AT1G62880 174 / 3e-57 Cornichon family protein (.1.2) AT4G12090 145 / 1e-45 Cornichon family protein (.1) AT3G12180 111 / 3e-32 Cornichon family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G116400 [exp] 229 / 5e-79 AT1G12390 182 / 2e-60 Cornichon family protein (.1) Potri.002G148500 [exp] 102 / 4e-29 AT1G12390 106 / 9e-31 Cornichon family protein (.1) Potri.006G057300 [exp] 91 / 5e-24 AT3G12180 109 / 3e-31 Cornichon family protein (.1) Potri.016G051000 [exp] 87 / 9e-23 AT3G12180 142 / 4e-44 Cornichon family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028906 [exp] 203 / 2e-68 AT1G12390 207 / 2e-70 Cornichon family protein (.1) Lus10004320 [exp] 200 / 3e-66 AT1G12390 173 / 1e-55 Cornichon family protein (.1) Lus10007000 [exp] 172 / 8e-56 AT1G12390 176 / 3e-57 Cornichon family protein (.1) Lus10006997 [exp] 172 / 8e-56 AT1G12390 176 / 3e-57 Cornichon family protein (.1) Lus10000384 [exp] 149 / 3e-47 AT1G12390 161 / 5e-52 Cornichon family protein (.1) Lus10009295 [exp] 132 / 2e-40 AT1G12390 142 / 7e-45 Cornichon family protein (.1) Lus10015866 [exp] 130 / 2e-40 AT1G12390 128 / 1e-39 Cornichon family protein (.1) Lus10030270 [exp] 114 / 7e-34 AT1G12390 94 / 2e-26 Cornichon family protein (.1) Lus10004023 [exp] 0 / 1 AT1G12340 101 / 5e-30 Cornichon family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03311 [poplar] [flax] Cornichon Cornichon protein
Representative CDS sequence Show only first row Show all	>Potri.001G116100.3 pacid=42789149 polypeptide=Potri.001G116100.3.p locus=Potri.001G116100 ID=Potri.001G116100.3.v4.1 annot-version=v4.1 ATGGGAGATCTCTTTGTATGGCTGATAGCCTTCTTCATTCTTATTGCCCTTCTTGTTATCGTCATCTTCCAGCTTATGGCCTTAGCAGATCTGGAGTTTG ATTACATCAATCCTTATGATTCCTCATCTCGGATAAATAAAGTGATTTTGCCAGAGTATATAACAGAAGGGGTTTTGTGCTTATTTTTTCTCATTACAGG GCACTGGTGTATGTCACTTTTGTGTATTCCATACCTTTATTACAATGTGAGGCTTTACACACAAAGACAGCATTTGGTAGATGTGACTGAGATATTCAAC ATGCTCAACTGGGAAAAGAAACAACGACTTTTCAAACTAGGCTATCTCGTTGTTCTCCTGTTTCTTTCGATTTTCTGGATGATTTTTACCGCCTTGGAAG ACAGTGATTATGATTAA
AA sequence Show only first row Show all	>Potri.001G116100.3 pacid=42789149 polypeptide=Potri.001G116100.3.p locus=Potri.001G116100 ID=Potri.001G116100.3.v4.1 annot-version=v4.1 MGDLFVWLIAFFILIALLVIVIFQLMALADLEFDYINPYDSSSRINKVILPEYITEGVLCLFFLITGHWCMSLLCIPYLYYNVRLYTQRQHLVDVTEIFN MLNWEKKQRLFKLGYLVVLLFLSIFWMIFTALEDSDYD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G12390			Cornichon family protein (.1)		Potri.001G116100 [exp]	0	1
AT4G34270			TIP41-like family protein (.1)		Potri.001G298500 [exp]	1.41	0.8861
AT5G53650			unknown protein		Potri.012G022900 [exp]	3.46	0.8691
AT1G10630		ATARFA1F	ADP-ribosylation factor A1F (....		Potri.005G007300 [exp]	7.93	0.8505
AT1G28120			unknown protein		Potri.003G162600 [exp]	9.27	0.7665
AT5G59560		SRR1	SENSITIVITY TO RED LIGHT REDUC...		Potri.001G026700 [exp]	12.88	0.7434
AT5G63135			unknown protein		Potri.012G085100 [exp]	14.49	0.8123
AT1G05720			selenoprotein family protein (...		Potri.013G126900 [exp]	16.49	0.8147
AT1G51650			ATP synthase epsilon chain, mi...		Potri.008G008900 [exp]	20.29	0.8470
AT1G72020			unknown protein		Potri.013G110600 [exp]	23.34	0.8340
					Potri.005G255701 [exp]	23.87	0.8242

Compare expression of checked genes

Potri.001G116100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.