Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G22760 100 / 4e-26 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G44230 94 / 8e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G39350 92 / 4e-23 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G49142 88 / 1e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G20230 88 / 1e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G57430 87 / 2e-21 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G22070 87 / 3e-21 pentatricopeptide (PPR) repeat-containing protein (.1) AT2G13600 86 / 5e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G26782 86 / 6e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G16835 86 / 7e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G116100 [exp] 133 / 5e-38 AT4G22760 669 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G175900 [exp] 96 / 2e-24 AT5G08510 608 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G119000 [exp] 95 / 3e-24 AT5G44230 792 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G005700 [exp] 91 / 1e-22 AT3G49142 912 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.007G085500 [exp] 91 / 1e-22 AT2G22070 1088 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.002G021300 [exp] 89 / 5e-22 AT1G20230 852 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G124400 [exp] 89 / 7e-22 AT5G39350 785 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.010G083700 [exp] 87 / 2e-21 AT3G22690 1050 / 0.0 unknown protein Potri.001G354400 [exp] 87 / 2e-21 AT5G46460 863 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028907 [exp] 117 / 3e-32 AT4G22760 632 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030225 [exp] 96 / 1e-24 AT5G08510 472 / 2e-165 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10000213 [exp] 94 / 1e-23 AT2G13600 435 / 8e-144 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10005987 [exp] 94 / 1e-23 AT5G08510 602 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10031989 [exp] 89 / 6e-22 AT3G26782 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10007772 [exp] 88 / 9e-22 AT4G37170 281 / 6e-87 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10000043 [exp] 83 / 4e-21 AT1G71490 253 / 1e-80 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10026460 [exp] 85 / 1e-20 AT1G15510 1030 / 0.0 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013149 [exp] 85 / 1e-20 AT1G56690 946 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10031028 [exp] 85 / 2e-20 AT4G19191 727 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G116350.1 pacid=42791659 polypeptide=Potri.001G116350.1.p locus=Potri.001G116350 ID=Potri.001G116350.1.v4.1 annot-version=v4.1 ATGGTCACTCTTTTAGGGAGAGCTGGAAGATTACAAGAGGCATGTGAGCTGACCATGCCAATGCAGCCTCATTCTAGGGCCTGGGGGACTTTGCTGCTTG CCTGCAGCGTGCATAACAATGTTGAGTTTGGAGAAATTGCAGCTCAGCGTCGTTTTGATTTGGAGCCTAATGCAACTGCTTATTATTCTCTTCTTGCCAA CATTCATTCCTCTGCTGGAAGGTGGGATGATGTCAGGAGATTGAGGAAGTTGTGGAAAGAGAAGAAACTGTCCAAGTTATCAGGGTGTAGTTAG
AA sequence Show only first row Show all	>Potri.001G116350.1 pacid=42791659 polypeptide=Potri.001G116350.1.p locus=Potri.001G116350 ID=Potri.001G116350.1.v4.1 annot-version=v4.1 MVTLLGRAGRLQEACELTMPMQPHSRAWGTLLLACSVHNNVEFGEIAAQRRFDLEPNATAYYSLLANIHSSAGRWDDVRRLRKLWKEKKLSKLSGCS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G22760			Tetratricopeptide repeat (TPR)...		Potri.001G116350 [exp]	0	1
AT2G45240		MAP1A	methionine aminopeptidase 1A (...		Potri.014G067300 [exp]	18.89	0.6337	MAP1.3
AT3G19610			Plant protein of unknown funct...		Potri.001G294600 [exp]	32.43	0.6703
AT1G61560		ATMLO6, MLO6	MILDEW RESISTANCE LOCUS O 6, S...		Potri.016G088000 [exp]	32.77	0.6645
AT4G36800		RCE1	RUB1 conjugating enzyme 1 (.1....		Potri.002G133632 [exp]	46.47	0.6433
AT1G04400		FHA, AT-PHH1, C...	cryptochrome 2 (.1.2)		Potri.008G166632 [exp]	60.54	0.6416
AT4G10310		ATHKT1, HKT1	high-affinity K+ transporter 1...		Potri.018G132200 [exp]	62.44	0.6269	Pt-HKT1.2
AT3G55550			Concanavalin A-like lectin pro...		Potri.006G144850 [exp]	64.48	0.6175
AT1G17370		UBP1B	oligouridylate binding protein...		Potri.001G166100 [exp]	72.12	0.6099
AT3G23940			dehydratase family (.1.2)		Potri.001G051700 [exp]	76.35	0.5922
AT2G17200		DSK2	ubiquitin family protein (.1)		Potri.005G100200 [exp]	84.85	0.5802

Compare expression of checked genes

Potri.001G116350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.