Potri.001G118700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G12340 124 / 2e-36 copper ion binding (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G114200 288 / 1e-100 AT4G12340 119 / 1e-34 copper ion binding (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024588 208 / 3e-69 AT4G12340 131 / 4e-39 copper ion binding (.1)
Lus10032225 205 / 6e-68 AT4G12340 134 / 4e-40 copper ion binding (.1)
PFAM info
Representative CDS sequence
>Potri.001G118700.2 pacid=42788181 polypeptide=Potri.001G118700.2.p locus=Potri.001G118700 ID=Potri.001G118700.2.v4.1 annot-version=v4.1
ATGGGTGATTTTTCTATTCAAATTACTCCAGAACTTGTTAATCGATTTGCTAATGATGGGGAGAAATTAAAGAAGAAAACAAAGAAGACTAAACCTAAGA
CCCAACGAGAACCTCCCCTGCCCAAACCTAAGGTGAATGAGAAACAGCTGCATGATGATTCTGAGACACGCAAAAGGATTGCTTCTCCAGGATGGCCAGT
TCAAACTCCAATGTACCTGCCAATAACCCAACCTGTACAGCCTGCAAATGCTGAGTTGGATGAGATTCGATCAGTCATTCGAGAGAGCGAGAGGGTTCTA
GAAAAGTTGCTGAAGCAGGAGGATAACATGGTGCAGAAAGTTACAGAAAGAGCCAAGGATCTTCGTGATAAGGAATTCAAGCTTCCATACCAGAAGACTA
TGCCCTGTTTGGCTGATTATGATGATTGCAAGGCATGCTACAAGGAGCACGCTAATGATATTTTGAAATGTGCCCCCTTCACTAAGAGTTATTATGAATG
TGTTCGCAGAGCTAAGCAGCAACAGAATTCAGCAGATAAGTAG
AA sequence
>Potri.001G118700.2 pacid=42788181 polypeptide=Potri.001G118700.2.p locus=Potri.001G118700 ID=Potri.001G118700.2.v4.1 annot-version=v4.1
MGDFSIQITPELVNRFANDGEKLKKKTKKTKPKTQREPPLPKPKVNEKQLHDDSETRKRIASPGWPVQTPMYLPITQPVQPANAELDEIRSVIRESERVL
EKLLKQEDNMVQKVTERAKDLRDKEFKLPYQKTMPCLADYDDCKACYKEHANDILKCAPFTKSYYECVRRAKQQQNSADK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G12340 copper ion binding (.1) Potri.001G118700 0 1
AT5G25450 Cytochrome bd ubiquinol oxidas... Potri.018G031400 1.73 0.8802
AT5G25450 Cytochrome bd ubiquinol oxidas... Potri.006G250000 4.58 0.8219
AT3G27320 alpha/beta-Hydrolases superfam... Potri.010G053700 6.32 0.8093
AT1G09780 iPGAM1 2,3-biphosphoglycerate-indepen... Potri.016G142900 6.32 0.8247 APGM.2
AT1G14360 ATUTR3, UTR3 UDP-galactose transporter 3 (.... Potri.016G139100 6.92 0.8282
AT2G27730 copper ion binding (.1) Potri.004G201700 7.07 0.8062
AT4G29520 unknown protein Potri.018G067300 7.34 0.8349
AT1G35780 unknown protein Potri.002G095300 10.95 0.7956
AT4G26510 UKL4 uridine kinase-like 4 (.1.2) Potri.011G165100 18.16 0.8240
AT2G39770 VTC1, SOZ1, GMP... VITAMIN C DEFECTIVE 1, SENSITI... Potri.008G060100 18.97 0.8019 Pt-EMB101.2

Potri.001G118700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.