Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62790 91 / 9e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G70250 91 / 4e-22 receptor serine/threonine kinase, putative (.1) AT1G73560 69 / 3e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G13900 66 / 2e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73550 66 / 3e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G18280 65 / 1e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44290 46 / 1e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 46 / 1e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 45 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12360 45 / 3e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G113900 [exp] 181 / 2e-59 AT1G70250 73 / 9e-16 receptor serine/threonine kinase, putative (.1) Potri.013G131500 [exp] 64 / 1e-13 AT5G13900 122 / 2e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G036201 [exp] 49 / 1e-07 AT1G18280 96 / 3e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232000 [exp] 45 / 2e-06 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 45 / 3e-06 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G008500 [exp] 43 / 2e-05 AT2G44290 155 / 6e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085400 [exp] 43 / 2e-05 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G053700 [exp] 40 / 0.0001 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G054000 [exp] 40 / 0.0001 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024591 [exp] 108 / 1e-30 AT1G62790 100 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10032228 [exp] 104 / 2e-29 AT1G70250 90 / 1e-23 receptor serine/threonine kinase, putative (.1) Lus10031335 [exp] 61 / 2e-11 AT3G17910 414 / 3e-142 SURFEIT 1, EMBRYO DEFECTIVE 3121, Surfeit locus 1 cytochrome c oxidase biogenesis protein (.1) Lus10010572 [exp] 57 / 2e-10 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 54 / 2e-09 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10014681 [exp] 47 / 5e-07 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10030541 [exp] 42 / 2e-05 AT3G07450 116 / 3e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10033076 [exp] 42 / 5e-05 AT2G44290 114 / 6e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042449 [exp] 41 / 0.0001 AT1G55260 160 / 3e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10017749 [exp] 39 / 0.0006 AT2G44290 115 / 3e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.001G119000.1 pacid=42789410 polypeptide=Potri.001G119000.1.p locus=Potri.001G119000 ID=Potri.001G119000.1.v4.1 annot-version=v4.1 ATGGCTTCTTCTCTCAAGATTTCTATTCTGGCGATGATGGTTGTAGTTTTTTTTTCGAGCGCGACAACCTTAACGAGAGCACAAGACCAGTCTACTTCTT GTGCATCTAAGTTAGTACCATGTCAAGCCTACCTCAGCACCACAACCCAGCCACCAGACAGCTGCTGCAACTCCATCAAAGAAGCGGTTGCAAATGAGCT TCCTTGTCTTTGCAAACTCTATAACGACCCCAATTTGTTTCAGAGTTTGGGTATAAATGTCACTCAGGCTGTCATGCTCAGCCAGAGATGCGGTGTCACC ACTAATCTCACTAGTTGCAGCGCTTCAGCTCCAACGCCAGCTGGTTCAGCAGTTCCTGGAAACGATGGAGATAATGGTGGTAGCAGGATGTCATTGTCGA CTGGACTTTCAGGCTTGCTCGTATTATTGGTCGCGTCTCTCCTGCATTAG
AA sequence Show only first row Show all	>Potri.001G119000.1 pacid=42789410 polypeptide=Potri.001G119000.1.p locus=Potri.001G119000 ID=Potri.001G119000.1.v4.1 annot-version=v4.1 MASSLKISILAMMVVVFFSSATTLTRAQDQSTSCASKLVPCQAYLSTTTQPPDSCCNSIKEAVANELPCLCKLYNDPNLFQSLGINVTQAVMLSQRCGVT TNLTSCSASAPTPAGSAVPGNDGDNGGSRMSLSTGLSGLLVLLVASLLH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G62790			Bifunctional inhibitor/lipid-t...		Potri.001G119000 [exp]	0	1
AT3G51840		ATG6, ATSCX, AC...	acyl-CoA oxidase 4 (.1)		Potri.016G118000 [exp]	1.00	0.8249
AT1G73760			RING/U-box superfamily protein...		Potri.015G043900 [exp]	2.44	0.7876
AT5G49710			unknown protein		Potri.002G104200 [exp]	4.24	0.7784
AT3G30390			Transmembrane amino acid trans...		Potri.017G106300 [exp]	6.63	0.7373
AT3G14130			Aldolase-type TIM barrel famil...		Potri.003G069400 [exp]	8.12	0.7532
AT2G39970		PXN, PMP38, APE...	peroxisomal NAD carrier, perox...		Potri.010G192600 [exp]	9.16	0.7402
AT2G47600		ATMHX1, ATMHX	MAGNESIUM/PROTON EXCHANGER 1, ...		Potri.014G128600 [exp]	12.44	0.7204	ATMHX.1
AT1G08230		ATGAT1	L-GAMMA-AMINOBUTYRIC ACID TRAN...		Potri.009G149900 [exp]	12.96	0.7681
					Potri.016G019100 [exp]	12.96	0.6865
AT2G28710	C2H2ZnF		C2H2-type zinc finger family p...		Potri.010G209400 [exp]	15.87	0.7412

Compare expression of checked genes

Potri.001G119000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.