Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62770 117 / 2e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G12390 104 / 2e-29 PME1 pectin methylesterase inhibitor 1 (.1) AT5G62350 102 / 7e-29 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25260 99 / 3e-27 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G47380 93 / 4e-25 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G62360 85 / 6e-22 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G14890 83 / 6e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G20740 79 / 1e-19 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G70720 74 / 2e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25250 72 / 3e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G113700 [exp] 160 / 1e-51 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1) Potri.015G128700 [exp] 111 / 2e-32 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127500 [exp] 110 / 6e-32 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.002G145800 [exp] 95 / 1e-25 AT4G00080 164 / 4e-51 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G119300 [exp] 92 / 1e-24 AT1G62760 167 / 3e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128100 [exp] 91 / 5e-24 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128300 [exp] 89 / 2e-23 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128200 [exp] 88 / 3e-23 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.014G067500 [exp] 88 / 8e-23 AT4G00080 156 / 1e-47 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038914 [exp] 112 / 8e-33 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027198 [exp] 110 / 4e-32 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10032230 [exp] 105 / 1e-29 AT1G62770 166 / 9e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10024593 [exp] 105 / 1e-29 AT1G62770 162 / 2e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031133 [exp] 101 / 3e-28 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031713 [exp] 94 / 2e-25 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10037919 [exp] 82 / 8e-21 AT1G14890 137 / 3e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031138 [exp] 81 / 4e-20 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031711 [exp] 76 / 2e-18 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10001988 [exp] 76 / 2e-18 AT4G00080 154 / 5e-47 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.001G119200.1 pacid=42792574 polypeptide=Potri.001G119200.1.p locus=Potri.001G119200 ID=Potri.001G119200.1.v4.1 annot-version=v4.1 ATGGGTGATCGTGCGGATCGACTAAGCCAGTCTGTCAGGGAGATTGGTCATATGGGTCGAGCTGTTGGTCAAGACTTTGTGTGGCATATGAGTAATGTGC AGACTTGGGTTAGCGCAGCACTTACTGATGAGAAAACTTGCCTTGATGGGTTTTCTAGCCATCTAATGGATGGAAATGTGAAGGCTGCCATTAAGCTCCG GATCACCAATGTTGCTCAGGTCACTAGCAATGCGCTTGCATTGGTCACTCGTTTTGCATCTAGACACCGTGCCAAAAATTCTTAG
AA sequence Show only first row Show all	>Potri.001G119200.1 pacid=42792574 polypeptide=Potri.001G119200.1.p locus=Potri.001G119200 ID=Potri.001G119200.1.v4.1 annot-version=v4.1 MGDRADRLSQSVREIGHMGRAVGQDFVWHMSNVQTWVSAALTDEKTCLDGFSSHLMDGNVKAAIKLRITNVAQVTSNALALVTRFASRHRAKNS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G62770			Plant invertase/pectin methyle...		Potri.001G119200 [exp]	0	1
AT5G16990			Zinc-binding dehydrogenase fam...		Potri.017G002600 [exp]	2.00	0.9546
AT1G50520		CYP705A27	"cytochrome P450, family 705, ...		Potri.009G065100 [exp]	3.31	0.9590
AT3G47570			Leucine-rich repeat protein ki...		Potri.008G007866 [exp]	3.87	0.9535
AT2G47020			Peptide chain release factor 1...		Potri.002G188200 [exp]	10.24	0.9428
AT5G45540			Protein of unknown function (D...		Potri.007G025500 [exp]	14.73	0.9353
AT3G26120		TEL1	terminal EAR1-like 1 (.1)		Potri.008G183000 [exp]	15.87	0.9398
AT3G11310			unknown protein		Potri.002G200700 [exp]	16.37	0.9224
AT1G53440			Leucine-rich repeat transmembr...		Potri.010G155150 [exp]	19.74	0.9540
					Potri.018G119100 [exp]	22.84	0.8882
					Potri.006G271901 [exp]	26.19	0.9509

Compare expression of checked genes

Potri.001G119200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.