Potri.001G120550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G22592 43 / 5e-08 CPuORF27 conserved peptide upstream open reading frame 27 (.1)
AT4G12432 42 / 6e-08 CPuORF26 conserved peptide upstream open reading frame 26 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G112350 71 / 6e-19 AT4G12432 46 / 2e-09 conserved peptide upstream open reading frame 26 (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.001G120550.1 pacid=42790661 polypeptide=Potri.001G120550.1.p locus=Potri.001G120550 ID=Potri.001G120550.1.v4.1 annot-version=v4.1
ATGTTGTGTAGCTTTGGAGATGACAAGTTCTCAGGAAGTGCTTGCTTGATGAACAGCTTTCCTAGTAGCAGCGACAAGAAAACATTGAAGAGGTGGTTTT
TCATTGATAAAAGGGTTGGGTAA
AA sequence
>Potri.001G120550.1 pacid=42790661 polypeptide=Potri.001G120550.1.p locus=Potri.001G120550 ID=Potri.001G120550.1.v4.1 annot-version=v4.1
MLCSFGDDKFSGSACLMNSFPSSSDKKTLKRWFFIDKRVG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G22592 CPuORF27 conserved peptide upstream ope... Potri.001G120550 0 1
AT5G45670 GDSL-like Lipase/Acylhydrolase... Potri.012G137600 2.23 0.8161
AT2G47540 Pollen Ole e 1 allergen and ex... Potri.014G126500 7.34 0.7997
AT4G27870 Vacuolar iron transporter (VIT... Potri.001G127900 7.61 0.8023
AT1G45688 unknown protein Potri.007G045000 12.96 0.7937
Potri.001G388300 16.49 0.7699
AT5G35550 MYB ATTT2, TT2, AtM... TRANSPARENT TESTA 2, MYB DOMAI... Potri.006G221500 21.21 0.7628 MYB183
AT1G78570 ATRHM1, RHM1, R... REPRESSOR OF LRX1 1, ARABIDOPS... Potri.006G272700 23.06 0.7349
AT1G70780 unknown protein Potri.008G131600 24.81 0.7003
AT2G22250 ATAAT, AAT, MEE... MATERNAL EFFECT EMBRYO ARREST ... Potri.007G088426 28.77 0.7257
Potri.001G388200 32.68 0.7863

Potri.001G120550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.