Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12480 95 / 1e-23 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12490 95 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12500 94 / 3e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12510 92 / 4e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 92 / 4e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 92 / 4e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 92 / 1e-22 AZI1 azelaic acid induced 1 (.1) AT4G12530 91 / 1e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12550 90 / 2e-22 AIR1 Auxin-Induced in Root cultures 1 (.1) AT4G00165 89 / 6e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G128800 [exp] 153 / 2e-46 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G200100 [exp] 115 / 2e-32 AT4G12470 69 / 8e-16 azelaic acid induced 1 (.1) Potri.018G025900 [exp] 94 / 6e-24 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G158400 [exp] 91 / 1e-22 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 91 / 2e-22 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 89 / 8e-22 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 89 / 8e-22 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G121800 [exp] 86 / 1e-20 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 83 / 8e-20 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032259 [exp] 102 / 3e-27 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032253 [exp] 99 / 2e-25 ND 139 / 2e-43 Lus10024616 [exp] 99 / 2e-25 AT4G12520 139 / 2e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024623 [exp] 99 / 3e-25 AT4G12490 152 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032254 [exp] 98 / 3e-25 AT4G12520 139 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024615 [exp] 99 / 5e-25 ND 139 / 6e-43 Lus10004348 [exp] 97 / 6e-25 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028929 [exp] 97 / 1e-24 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024626 [exp] 96 / 3e-24 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 96 / 4e-24 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14547 [poplar] [flax] Hydrophob_seed Hydrophobic seed protein
Representative CDS sequence Show only first row Show all	>Potri.001G122100.2 pacid=42793443 polypeptide=Potri.001G122100.2.p locus=Potri.001G122100 ID=Potri.001G122100.2.v4.1 annot-version=v4.1 ATGGCTTCAGGAGCACTAGCCTCCAATGCCCTTCTCCTCTCCCTCTACATCTTATTTTTGGCTTTGCTGAGCTCCGCTGAGTATTGCCCACCATCACCAC CCAAGGTCAAGTCACCGCCTCCACCACCACCCAAGGCCAAGTCACCACCTCCACCACCCAAGGTCAAGTCACCACCTCCACCACCACCCAAGGTCAAGTC ACCTCCACCACCCAAGGTCAAGTCACCACCTCCACCACCCAAGGTCAAGTCACCACCTCCACCACCACCCAAGGTCAAGTCACCTCCACCACCCAAGGTC AAGTCACCACCTCCACCACCCAAGGTCAAGTCACCTCCACCACCCAAGGTCAAGTCACCACCTCCACCCAAGGTCAAGTCACCACCCCCACCACCCAAGG TCAAGTCACCACCCCCACCGCCACCAATGGTCATGTCACCACCACCACCAATTGTCAAGTCACCACCGCCACCAATGGTCATGTCACCGCCACCACCAAT TGTCAAGTCACCGCCACCACCAATGGCCAAGTCACCACCACCACCAATTGACAATTCACCGCCACCACCACCAATGTTCAAGTCACCACCACCACCACCT CCATCACTACCAAAAGGCACTTGCCCTAGAGATACCTTGAAGTTGCAAGCATGCGCAAATGTGCTGAATTTGTTGAAAATCTTTGTTGGTGAAAAAGAAA AGGCCAAATGCTGCAGCCTCATTGATGGTCTTGTTGATCTTGATGCTGCTGTTTGCCTTTGCACTCGAATCAAAGTTGATCTCCTGGGCCTTATTAAGTT AGACGTTCCTGTTGCCGTGGAGTTGTTGCTCAACGAATGCGATAGGAAGGTCGCGGAAGATTTCAAGTGTCCGCCCTCCTAA
AA sequence Show only first row Show all	>Potri.001G122100.2 pacid=42793443 polypeptide=Potri.001G122100.2.p locus=Potri.001G122100 ID=Potri.001G122100.2.v4.1 annot-version=v4.1 MASGALASNALLLSLYILFLALLSSAEYCPPSPPKVKSPPPPPPKAKSPPPPPKVKSPPPPPPKVKSPPPPKVKSPPPPPKVKSPPPPPPKVKSPPPPKV KSPPPPPKVKSPPPPKVKSPPPPKVKSPPPPPKVKSPPPPPPMVMSPPPPIVKSPPPPMVMSPPPPIVKSPPPPMAKSPPPPIDNSPPPPPMFKSPPPPP PSLPKGTCPRDTLKLQACANVLNLLKIFVGEKEKAKCCSLIDGLVDLDAAVCLCTRIKVDLLGLIKLDVPVAVELLLNECDRKVAEDFKCPPS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G12480		PEARLI 1 1, PEA...	EARLY ARABIDOPSIS ALUMINUM IND...		Potri.001G122100 [exp]	0	1
AT4G35220			Cyclase family protein (.1)		Potri.001G301700 [exp]	1.41	0.9807
AT3G21420		LBO1	LATERAL BRANCHING OXIDOREDUCTA...		Potri.010G201000 [exp]	2.82	0.9639
					Potri.013G045700 [exp]	5.29	0.9372
AT3G63520		ATNCED1, ATCCD1...	carotenoid cleavage dioxygenas...		Potri.018G042650 [exp]	6.63	0.9569
AT5G45120			Eukaryotic aspartyl protease f...		Potri.015G113100 [exp]	7.41	0.9222
AT3G10720			Plant invertase/pectin methyle...		Potri.008G011100 [exp]	7.74	0.9497
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Potri.011G028100 [exp]	8.12	0.9372
AT1G11330			S-locus lectin protein kinase ...		Potri.011G037800 [exp]	20.19	0.9145
AT5G52390			PAR1 protein (.1)		Potri.009G040000 [exp]	21.44	0.9119
AT2G45220			Plant invertase/pectin methyle...		Potri.015G127700 [exp]	23.49	0.9220	Pt-PME.5

Compare expression of checked genes

Potri.001G122100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.