Potri.001G122501 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16510 0 / 1 YbaK/aminoacyl-tRNA synthetase-associated domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G135980 76 / 1e-16 AT4G16510 342 / 2e-120 YbaK/aminoacyl-tRNA synthetase-associated domain (.1)
Potri.003G111100 76 / 1e-16 AT4G16510 346 / 7e-122 YbaK/aminoacyl-tRNA synthetase-associated domain (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000734 72 / 1e-15 AT4G16510 324 / 2e-113 YbaK/aminoacyl-tRNA synthetase-associated domain (.1)
Lus10008505 0 / 1 AT4G16510 298 / 9e-103 YbaK/aminoacyl-tRNA synthetase-associated domain (.1)
PFAM info
Representative CDS sequence
>Potri.001G122501.1 pacid=42787569 polypeptide=Potri.001G122501.1.p locus=Potri.001G122501 ID=Potri.001G122501.1.v4.1 annot-version=v4.1
ATGGAATATCAAACCTGGATCTCACTCTCCTCTCCAAACAACGATCTCTCCGCCGCCGCCAACGACGTCATGGGGCCACCGAAGCTCGTCTCTCCGCCAT
TATCCGATCAAACGGGTGTCACTGACTTCGTCTTCGTAAAAGCTCCCACCGATTACTACGACCGGTCTATCGAGTCCCGACTCGACAATCTCGGTGCCGC
CTCTATTCATCACCGCTGTAAAAGGATCGTCTTGGTTAATACACAGGCCCCATCCCAAATCATTGACTGCGCAGTGATCACAATAATTCAAAGTATTGCA
TTGTTGTTGTTCTGCACACTGTTTGATTCAATGCTGAAGCGGTTAAAAACTATTTGTTTGCACTCAACGATGGGAAGGTATCTAAAAAGAAAATCAATTG
TAAGTTGTTATCCTCTTGATGATCATAAAGGCTCATATAACAACTTAAATAATCATTCTTCAAATGGAAAGGAGTGGTTTATTGATATAGGTTGCAAGTG
TTTTTCAAGTCATTATGAATACATTTTCTGTGAATTCTCTTATGCCTTTGTGAACAAATAA
AA sequence
>Potri.001G122501.1 pacid=42787569 polypeptide=Potri.001G122501.1.p locus=Potri.001G122501 ID=Potri.001G122501.1.v4.1 annot-version=v4.1
MEYQTWISLSSPNNDLSAAANDVMGPPKLVSPPLSDQTGVTDFVFVKAPTDYYDRSIESRLDNLGAASIHHRCKRIVLVNTQAPSQIIDCAVITIIQSIA
LLLFCTLFDSMLKRLKTICLHSTMGRYLKRKSIVSCYPLDDHKGSYNNLNNHSSNGKEWFIDIGCKCFSSHYEYIFCEFSYAFVNK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G16510 YbaK/aminoacyl-tRNA synthetase... Potri.001G122501 0 1
AT2G03140 alpha/beta-Hydrolases superfam... Potri.006G136900 6.16 0.8543
AT4G04885 PCFS4 PCF11P-similar protein 4 (.1) Potri.011G024800 7.48 0.8670
AT2G25970 KH domain-containing protein (... Potri.006G231800 7.74 0.8157
AT5G13950 unknown protein Potri.014G144100 7.93 0.8455
AT1G68930 pentatricopeptide (PPR) repeat... Potri.008G113101 8.77 0.8276
Potri.004G206650 11.66 0.8208
AT5G56290 EMB2790, PEX5, ... EMBRYO DEFECTIVE 2790, ARABIDO... Potri.011G170000 18.65 0.8265 Pt-PEX5.1
AT3G18110 EMB1270 embryo defective 1270, Pentatr... Potri.017G036400 18.76 0.8292
AT1G79020 Enhancer of polycomb-like tran... Potri.014G000600 19.59 0.8238
AT5G22450 unknown protein Potri.010G238400 19.79 0.8392

Potri.001G122501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.