Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G02250 98 / 4e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G55770 88 / 5e-22 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17220 69 / 9e-15 ATPMEI2 pectin methylesterase inhibitor 2 (.1) AT5G46940 52 / 2e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46970 50 / 5e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G02550 48 / 6e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G38610 44 / 9e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62760 40 / 0.0005 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17152 39 / 0.0008 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G016500 [exp] 202 / 7e-67 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.014G044100 [exp] 79 / 2e-18 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.006G134900 [exp] 74 / 9e-17 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.003G086500 [exp] 64 / 8e-13 AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G086600 [exp] 61 / 7e-12 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.008G013400 [exp] 60 / 3e-11 AT5G64620 66 / 8e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.007G108301 [exp] 54 / 4e-09 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.016G001600 [exp] 50 / 8e-08 AT5G64620 82 / 9e-20 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.001G109700 [exp] 47 / 1e-06 AT1G47960 46 / 2e-06 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001464 [exp] 147 / 5e-45 AT4G02250 112 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10008201 [exp] 130 / 1e-38 AT4G02250 113 / 3e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10015199 [exp] 66 / 1e-13 AT5G46940 67 / 8e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10041650 [exp] 65 / 3e-13 AT1G48020 85 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1) Lus10031483 [exp] 64 / 1e-12 AT5G46940 64 / 8e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10029877 [exp] 60 / 2e-11 AT5G64620 67 / 7e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10017345 [exp] 60 / 2e-11 AT3G17220 89 / 1e-22 pectin methylesterase inhibitor 2 (.1) Lus10022409 [exp] 59 / 6e-11 AT5G64620 155 / 3e-48 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10003530 [exp] 58 / 9e-11 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10002933 [exp] 58 / 1e-10 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.001G127500.1 pacid=42790840 polypeptide=Potri.001G127500.1.p locus=Potri.001G127500 ID=Potri.001G127500.1.v4.1 annot-version=v4.1 ATGAAGCCCATTACAAGTTTTGTCCTGTTTTCTTTAACCCTCAGCCTCACCCTCTCTCTCCTTGCATCTGTTGCCAATGCGGACACCAATCTAATCGACA AAGTATGCGCACGCACCCATAACAAGAATAGTTGTGTTGCAGTTTTTGAATCTAACCCCGATAGCAAACAAGCCGATTTGAAACAACTAGGCATAATCGC ATTAACCCTTGCATCTTCAAAAGCAACAGAGACATCGCAGTACATCAAGACTCTGCTTCTTAACAAGACTTTGGACCCTGTCATTGATCAGGCCCTCTCC GACTGCTCAGACCAATACTTGGATGCCATCCAGCAACTCGGTGACGCATCGTCTGATTTGTTAGAGGACGGTACTAAAGACGTTCGTACTTCGGTGAAAG CAGCAATTGCTGCTGCACAATCATGTGAGAACGGGTTCGTGGAAAGTTCTGGCCGTGAAATTTTGCTGTCGAGAAACGCAATCTTCCGCCAATTATGCAA CAATGTCTTGGTCATCAACAAACTCTTGGAAGAAAAGTGA
AA sequence Show only first row Show all	>Potri.001G127500.1 pacid=42790840 polypeptide=Potri.001G127500.1.p locus=Potri.001G127500 ID=Potri.001G127500.1.v4.1 annot-version=v4.1 MKPITSFVLFSLTLSLTLSLLASVANADTNLIDKVCARTHNKNSCVAVFESNPDSKQADLKQLGIIALTLASSKATETSQYIKTLLLNKTLDPVIDQALS DCSDQYLDAIQQLGDASSDLLEDGTKDVRTSVKAAIAAAQSCENGFVESSGREILLSRNAIFRQLCNNVLVINKLLEEK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G02250			Plant invertase/pectin methyle...		Potri.001G127500 [exp]	0	1
AT5G17540			HXXXD-type acyl-transferase fa...		Potri.001G127600 [exp]	1.00	0.9534
AT2G46940			unknown protein		Potri.014G111000 [exp]	6.63	0.8012
AT3G06390			Uncharacterised protein family...		Potri.008G205000 [exp]	9.00	0.7855
AT3G48980			Arabidopsis thaliana protein o...		Potri.001G106500 [exp]	10.00	0.7748
AT5G02020		SIS	Salt Induced Serine rich, unkn...		Potri.006G092400 [exp]	11.83	0.7548
AT2G41870			Remorin family protein (.1)		Potri.016G054400 [exp]	20.34	0.7614
AT1G56600		ATGOLS2	galactinol synthase 2 (.1)		Potri.013G005800 [exp]	34.92	0.7326
AT4G12680			unknown protein		Potri.007G035400 [exp]	40.98	0.7199
AT5G43580		UPI	UNUSUAL SERINE PROTEASE INHIBI...		Potri.010G075501 [exp]	62.22	0.7165
					Potri.012G115400 [exp]	70.72	0.6733

Compare expression of checked genes

Potri.001G127500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.