Plant FIBer expression Database

Potri.001G129500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034731
[exp]
129 / 3e-41 ND /
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0361 C2H2-zf PF12874 zf-met Zinc-finger of C2H2 type
Representative CDS sequence
>Potri.001G129500.3 pacid=42788290 polypeptide=Potri.001G129500.3.p locus=Potri.001G129500 ID=Potri.001G129500.3.v4.1 annot-version=v4.1
ATGACTCGAGGAAAGCAGAAGATCGAAGCCCAGAGGAAAAACGCAGAAAGGAATCAGAAATCTAAGGGATCTCAGTTTGAAGCCCGAGCTGTTGCTCTCA
AGGTTACCTGCTCCATCTGTAAGGTTCAGCTGGCGAATAGTAATCAACTAGGTGATCATTATGCCTCCAAACATCCAAAAGAGAAGCCTCCTGCTGAATC
GAGCTGA
AA sequence
>Potri.001G129500.3 pacid=42788290 polypeptide=Potri.001G129500.3.p locus=Potri.001G129500 ID=Potri.001G129500.3.v4.1 annot-version=v4.1
MTRGKQKIEAQRKNAERNQKSKGSQFEARAVALKVTCSICKVQLANSNQLGDHYASKHPKEKPPAESS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G129500
[exp]
0 1
AT1G49245 Prefoldin chaperone subunit fa... Potri.013G072700
[exp]
3.46 0.7687
AT1G72175 RING/U-box protein with domain... Potri.013G105400
[exp]
3.46 0.7952
AT3G23325 Splicing factor 3B subunit 5/R... Potri.010G070500
[exp]
7.74 0.7837
AT5G20165 unknown protein Potri.010G058300
[exp]
12.04 0.8014
AT1G05720 selenoprotein family protein (... Potri.013G126900
[exp]
14.38 0.7933
AT1G07890 ATAPX01, CS1, A... maternal effect embryo arrest ... Potri.009G015400
[exp]
14.62 0.6690 APX.3
AT1G80500 SNARE-like superfamily protein... Potri.001G043400
[exp]
14.83 0.7637
AT5G55190 RAN3, ATRAN3 RAN GTPase 3 (.1) Potri.018G030700
[exp]
16.49 0.7437
AT1G61700 RNA polymerases N / 8 kDa subu... Potri.003G102900
[exp]
20.04 0.6925
AT1G05205 unknown protein Potri.018G093501
[exp]
20.49 0.7257

Potri.001G129500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.