Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G07840 209 / 8e-70 PIA1 phytochrome interacting ankyrin-repeat protein 1, Ankyrin repeat family protein (.1) AT5G61230 207 / 5e-69 PIA2, ANK6 phytochrome interacting ankyrin-repeat protein 2, ankyrin repeat protein 6, Ankyrin repeat family protein (.1) AT2G03430 64 / 8e-13 Ankyrin repeat family protein (.1) AT2G43850 56 / 3e-09 Integrin-linked protein kinase family (.1.2) AT3G04710 55 / 5e-09 TPR10 tetratricopeptide repeat 10, ankyrin repeat family protein (.1.2.3) AT4G19150 53 / 9e-09 Ankyrin repeat family protein (.1.2) AT5G02620 53 / 2e-08 ATANK1, ANK1 ankyrin-like1 (.1) AT2G31800 52 / 3e-08 Integrin-linked protein kinase family (.1) AT3G59830 52 / 6e-08 Integrin-linked protein kinase family (.1) AT5G60070 50 / 2e-07 ankyrin repeat family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G104400 [exp] 283 / 6e-99 AT5G61230 217 / 4e-73 phytochrome interacting ankyrin-repeat protein 2, ankyrin repeat protein 6, Ankyrin repeat family protein (.1) Potri.010G185200 [exp] 62 / 1e-11 AT2G03430 76 / 3e-15 Ankyrin repeat family protein (.1) Potri.013G062000 [exp] 61 / 4e-11 AT2G03430 94 / 2e-21 Ankyrin repeat family protein (.1) Potri.010G161300 [exp] 58 / 2e-10 AT2G03430 356 / 1e-125 Ankyrin repeat family protein (.1) Potri.001G130500 [exp] 56 / 1e-09 AT4G19150 222 / 1e-72 Ankyrin repeat family protein (.1.2) Potri.003G103400 [exp] 56 / 1e-09 AT4G19150 234 / 2e-77 Ankyrin repeat family protein (.1.2) Potri.007G099600 [exp] 56 / 2e-09 AT1G07710 745 / 0.0 Ankyrin repeat family protein (.1) Potri.007G142100 [exp] 56 / 2e-09 AT2G43850 726 / 0.0 Integrin-linked protein kinase family (.1.2) Potri.001G238800 [exp] 54 / 6e-09 AT2G28840 657 / 0.0 XB3 ortholog 1 in Arabidopsis thaliana (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033816 [exp] 235 / 4e-80 AT5G07840 232 / 1e-78 phytochrome interacting ankyrin-repeat protein 1, Ankyrin repeat family protein (.1) Lus10018958 [exp] 227 / 6e-77 AT5G07840 228 / 3e-77 phytochrome interacting ankyrin-repeat protein 1, Ankyrin repeat family protein (.1) Lus10007432 [exp] 61 / 3e-11 AT2G31800 69 / 3e-13 Integrin-linked protein kinase family (.1) Lus10002621 [exp] 59 / 2e-10 AT5G13530 99 / 6e-22 KEEP ON GOING, protein kinases;ubiquitin-protein ligases (.1.2) Lus10020272 [exp] 57 / 1e-09 AT5G13530 97 / 9e-21 KEEP ON GOING, protein kinases;ubiquitin-protein ligases (.1.2) Lus10027107 [exp] 54 / 2e-08 AT2G31800 709 / 0.0 Integrin-linked protein kinase family (.1) Lus10040829 [exp] 53 / 2e-08 AT2G28840 546 / 0.0 XB3 ortholog 1 in Arabidopsis thaliana (.1.2) Lus10016561 [exp] 52 / 3e-08 AT2G28840 640 / 0.0 XB3 ortholog 1 in Arabidopsis thaliana (.1.2) Lus10008350 [exp] 52 / 4e-08 AT2G31800 753 / 0.0 Integrin-linked protein kinase family (.1) Lus10001048 [exp] 51 / 6e-08 AT4G19150 230 / 6e-76 Ankyrin repeat family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0465 [poplar] [flax] Ank PF12796 [poplar] [flax] Ank_2 Ankyrin repeats (3 copies)
Representative CDS sequence Show only first row Show all	>Potri.001G129800.1 pacid=42787645 polypeptide=Potri.001G129800.1.p locus=Potri.001G129800 ID=Potri.001G129800.1.v4.1 annot-version=v4.1 ATGCCACAGGAAGATTGTGTTGCTGTTTCGTTGAGGCGTAACTTGTCGAGAAGACGGTCGTTTAGGTCAGTTGGGGGTGTTGACAGAGATGATAGAGGTT GGACTTCGCTTCATATTGGTGCTAGAAAAGGTGATCTCAAACAGGTGAAACATTTACTCGATGAAGGAATGGATGTTAATGTGCCTGCATGGGGCCCAAA ATCAAAAGGCCTGACCGCGCTCCACCTTGCTGCTCAGGGTGGTCACCTTGAGATTATGGATGAATTGCTTGCTCGTGGTGCTAATATTGATGCTAGAACC CTGGGTGCCTGTGGTTGGACACCACTTCACCGTGCTGCAAAGGAAAGGAAGAAAGAAGCAGTCAAATTTCTAATAGAGAACGGTGCATTCTTGCCAGATG ATATGAATGATAGCAGATTTAACCCGCCACTCCATTACTGCACCGGTCTTGAATGGGCATATGAGGAGATGAAGCGTCATCAGAGAGAGAATTTGTCAGC AGGCGAAGCATCCTACAGCTCTGAAAGCTAA
AA sequence Show only first row Show all	>Potri.001G129800.1 pacid=42787645 polypeptide=Potri.001G129800.1.p locus=Potri.001G129800 ID=Potri.001G129800.1.v4.1 annot-version=v4.1 MPQEDCVAVSLRRNLSRRRSFRSVGGVDRDDRGWTSLHIGARKGDLKQVKHLLDEGMDVNVPAWGPKSKGLTALHLAAQGGHLEIMDELLARGANIDART LGACGWTPLHRAAKERKKEAVKFLIENGAFLPDDMNDSRFNPPLHYCTGLEWAYEEMKRHQRENLSAGEASYSSES

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G61230		PIA2, ANK6	phytochrome interacting ankyri...		Potri.001G129800 [exp]	0	1
					Potri.007G125700 [exp]	5.56	0.7611
AT1G75180			Erythronate-4-phosphate dehydr...		Potri.002G260900 [exp]	11.22	0.7040
AT1G12760			Zinc finger, C3HC4 type (RING ...		Potri.003G123300 [exp]	13.22	0.7040
AT4G34610	HD	BLH6	BEL1-like homeodomain 6 (.1.2)		Potri.009G120800 [exp]	19.05	0.6991
AT5G51940		NRPE6A, NRPD6A,...	RNA polymerase Rpb6 (.1)		Potri.015G138800 [exp]	22.44	0.6943
AT2G31160		OBO1, LSH3	ORGAN BOUNDARY 1, LIGHT SENSIT...		Potri.001G460400 [exp]	22.97	0.7020
					Potri.009G003650 [exp]	33.00	0.7019
AT3G07300			NagB/RpiA/CoA transferase-like...		Potri.001G026100 [exp]	33.61	0.7002
AT4G00355		ATI2	ATG8-interacting protein 2, un...		Potri.002G160700 [exp]	39.11	0.6843
AT2G17975			zinc finger (Ran-binding) fami...		Potri.005G115100 [exp]	43.95	0.6646

Compare expression of checked genes

Potri.001G129800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.