Potri.001G130200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G31812 140 / 5e-45 ACBP6, ACBP acyl-CoA-binding protein 6 (.1)
AT5G53470 62 / 1e-12 ACBP1 acyl-CoA binding protein 1 (.1)
AT4G27780 56 / 2e-10 ACBP2 acyl-CoA binding protein 2 (.1)
AT3G05420 51 / 1e-08 ACBP4 acyl-CoA binding protein 4 (.1.2)
AT5G27630 49 / 5e-08 ACBP5 acyl-CoA binding protein 5 (.1)
AT4G24230 47 / 1e-07 ACBP3 acyl-CoA-binding domain 3 (.1.2.3.4.5.6)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G103700 177 / 1e-59 AT1G31812 138 / 2e-44 acyl-CoA-binding protein 6 (.1)
Potri.005G026900 54 / 6e-10 AT3G05420 1005 / 0.0 acyl-CoA binding protein 4 (.1.2)
Potri.013G018800 52 / 3e-09 AT3G05420 999 / 0.0 acyl-CoA binding protein 4 (.1.2)
Potri.015G010200 52 / 4e-09 AT4G27780 432 / 3e-152 acyl-CoA binding protein 2 (.1)
Potri.012G017700 52 / 5e-09 AT4G27780 432 / 4e-152 acyl-CoA binding protein 2 (.1)
Potri.014G018700 47 / 2e-07 AT4G24230 133 / 2e-35 acyl-CoA-binding domain 3 (.1.2.3.4.5.6)
Potri.002G120200 46 / 5e-07 AT4G24230 113 / 3e-28 acyl-CoA-binding domain 3 (.1.2.3.4.5.6)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013605 156 / 2e-51 AT1G31812 132 / 1e-41 acyl-CoA-binding protein 6 (.1)
Lus10021246 156 / 6e-51 AT1G31812 132 / 1e-41 acyl-CoA-binding protein 6 (.1)
Lus10029352 139 / 1e-44 AT1G31812 110 / 2e-33 acyl-CoA-binding protein 6 (.1)
Lus10005910 56 / 1e-10 AT4G27780 430 / 3e-151 acyl-CoA binding protein 2 (.1)
Lus10022382 56 / 2e-10 AT4G27780 432 / 2e-152 acyl-CoA binding protein 2 (.1)
Lus10004499 54 / 9e-10 AT3G05420 1019 / 0.0 acyl-CoA binding protein 4 (.1.2)
Lus10029902 54 / 9e-10 AT3G05420 1040 / 0.0 acyl-CoA binding protein 4 (.1.2)
Lus10015176 52 / 3e-09 AT3G05420 1024 / 0.0 acyl-CoA binding protein 4 (.1.2)
Lus10031497 52 / 3e-09 AT3G05420 1027 / 0.0 acyl-CoA binding protein 4 (.1.2)
Lus10007764 39 / 0.0001 AT4G24230 141 / 1e-38 acyl-CoA-binding domain 3 (.1.2.3.4.5.6)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0632 FERM_M PF00887 ACBP Acyl CoA binding protein
Representative CDS sequence
>Potri.001G130200.2 pacid=42789909 polypeptide=Potri.001G130200.2.p locus=Potri.001G130200 ID=Potri.001G130200.2.v4.1 annot-version=v4.1
ATGGGTTTGCAGGAGGAATTTCAGGAGCATTCTGAGAAAGCCAAGACTCTGCCAGAAAATACAACAAATGAGAATAAACTTATTCTCTATGGGCTCTACA
AGCAAGCCACTGTTGGACCAGTGAACACCAGCCGCCCTGGAATTTTCAACATGAGGGACAGGGCAAAGTGGGATGCATGGAAGGCTGTTGAAGGAAATTC
CAAGGAGGAAGCAATGAGTGACTATATCACCAAGGTTAAGCAGTTGCTGGAAGAAGCTGCTGCTTCTGCCTAG
AA sequence
>Potri.001G130200.2 pacid=42789909 polypeptide=Potri.001G130200.2.p locus=Potri.001G130200 ID=Potri.001G130200.2.v4.1 annot-version=v4.1
MGLQEEFQEHSEKAKTLPENTTNENKLILYGLYKQATVGPVNTSRPGIFNMRDRAKWDAWKAVEGNSKEEAMSDYITKVKQLLEEAAASA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G31812 ACBP6, ACBP acyl-CoA-binding protein 6 (.1... Potri.001G130200 0 1
AT2G46800 ATMTP1, ZAT1, Z... ZINC TRANSPORTER OF ARABIDOPSI... Potri.001G450900 1.00 0.8130
AT1G51060 HTA10 histone H2A 10 (.1) Potri.011G131400 3.46 0.7834 HTA901
AT1G03250 unknown protein Potri.019G046400 3.74 0.7714
AT5G10730 NAD(P)-binding Rossmann-fold s... Potri.004G106300 7.68 0.7003
AT5G26751 ATSK11 ,SK 11 ARABIDOPSIS THALIANA SHAGGY-RE... Potri.013G004700 13.41 0.6802 MSK.4
AT5G59890 ADF4, ATADF4 actin depolymerizing factor 4 ... Potri.010G208500 13.63 0.7172
AT4G15800 RALFL33 ralf-like 33 (.1) Potri.005G025800 14.24 0.7193 RALFL23.2
AT4G34720 ATVHA-C1, AVA-P... VACUOLAR H+-PUMPING ATPASE C1,... Potri.009G125000 14.42 0.7835 Pt-AVAP5.2
AT2G42500 PP2A-3, PP2A-4 protein phosphatase 2A-3 (.1.2... Potri.003G217900 16.52 0.7355 Pt-PP2.3
AT1G51200 A20/AN1-like zinc finger famil... Potri.016G051700 20.97 0.7371

Potri.001G130200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.