Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45390 239 / 2e-79 NCLPP3, NCLPP4, CLPP4 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) AT1G66670 162 / 5e-49 NCLPP3, NCLPP4, CLPP3 CLP protease proteolytic subunit 3 (.1) AT1G02560 144 / 5e-42 NCLPP5, NCLPP1, CLPP5 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) AT1G11750 129 / 1e-36 NCLPP6, NCLPP1, CLPP6 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) AT5G23140 125 / 2e-35 NCLPP7, NCLPP2, CLPP2 nuclear-encoded CLP protease P7 (.1) ATCG00670 115 / 5e-32 PCLPP, ATCG00670.1, CLPP1 CASEINOLYTIC PROTEASE P 1, plastid-encoded CLP P (.1) AT1G12410 110 / 2e-29 EMB3146, CLP2, NCLPP2, CLPR2 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) AT4G17040 90 / 3e-21 HON5, CLPR4 happy on norflurazon 5, CLP protease R subunit 4 (.1) AT1G49970 85 / 3e-19 SVR2, NCLPP5, CLPR1 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1) AT1G09130 84 / 3e-19 ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.1), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.2), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G103300 [exp] 292 / 4e-100 AT5G45390 383 / 9e-135 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Potri.004G092100 [exp] 167 / 9e-51 AT1G66670 441 / 2e-156 CLP protease proteolytic subunit 3 (.1) Potri.002G195200 [exp] 142 / 3e-41 AT1G02560 474 / 2e-170 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.014G119700 [exp] 141 / 4e-41 AT1G02560 493 / 6e-178 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.004G152900 [exp] 132 / 9e-38 AT1G11750 397 / 4e-141 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.009G114001 [exp] 131 / 2e-37 AT1G11750 353 / 2e-123 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.007G071700 [exp] 129 / 1e-36 AT5G23140 383 / 1e-135 nuclear-encoded CLP protease P7 (.1) Potri.005G092600 [exp] 127 / 3e-36 AT5G23140 380 / 3e-135 nuclear-encoded CLP protease P7 (.1) Potri.001G115900 [exp] 104 / 4e-27 AT1G12410 408 / 3e-145 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007589 [exp] 189 / 4e-60 AT5G45390 293 / 2e-99 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Lus10012156 [exp] 189 / 5e-60 AT5G45390 293 / 1e-99 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Lus10010979 [exp] 144 / 6e-42 AT1G66670 288 / 6e-97 CLP protease proteolytic subunit 3 (.1) Lus10000449 [exp] 143 / 2e-41 AT1G66670 285 / 1e-95 CLP protease proteolytic subunit 3 (.1) Lus10002422 [exp] 130 / 6e-37 AT1G02560 361 / 4e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10010003 [exp] 129 / 2e-36 AT1G02560 308 / 2e-105 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10001450 [exp] 130 / 3e-36 AT1G02560 365 / 1e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10025022 [exp] 129 / 3e-36 AT1G02560 313 / 3e-107 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10010196 [exp] 125 / 2e-35 AT5G23140 395 / 4e-141 nuclear-encoded CLP protease P7 (.1) Lus10017397 [exp] 124 / 5e-35 AT5G23140 394 / 1e-140 nuclear-encoded CLP protease P7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0127 [poplar] [flax] ClpP_crotonase PF00574 [poplar] [flax] CLP_protease Clp protease
Representative CDS sequence Show only first row Show all	>Potri.001G130601.2 pacid=42792452 polypeptide=Potri.001G130601.2.p locus=Potri.001G130601 ID=Potri.001G130601.2.v4.1 annot-version=v4.1 ATGGATCTGCTCTCGTTCTCGTCCTCCACAGCAACCTCACAATTTTCCTCTGAAAAACCCACTCTCTCTCACCACCACCACCAAAACCCCACTTCATTTT TCCCCTTCAGTTTCAAACACATTACACCATCTTCTCCAAAACTTTCACCTCTCAAAACCTCCCTTAAATCCTCGAAGACCCTAACTCCAATTCCCCAACT GGACGCTCCTCAAACACCGGCCACCTCCATGAGAGGGGCTGAGACGGACACTATGGGTCTATTGTTGAGGGAGAGGATTGTGTTTCTAGGGAACAGTATA GATGATTTTGTGGCTGATGCTATTATTAGCCAGTTGTTGCTTCTTGATGCTCAGGATCCTACTAAAGATATCCGTCTCTTCATCAATTGTCCTGGTGGTT CTCCTAGTGCTACAATGGCTATCTATGATGTGGTGCAGCTTGTGAGGGCTGATGTTTCCACAGTTGCTCTTGGCATTGCAGCATCAACAGCTTCTATAAT TCTTGGTGGTGGAACGAAAGGCAAGCGTTTTGCAATGCCCAACACACGGATAATGATTCATCAACCTCTTGGAGGAGCTAGTGGGCAAGCAATAAATGTG GAAATTCAAGCACGAGAATTATGCAAAACAAGAATAATGTAA
AA sequence Show only first row Show all	>Potri.001G130601.2 pacid=42792452 polypeptide=Potri.001G130601.2.p locus=Potri.001G130601 ID=Potri.001G130601.2.v4.1 annot-version=v4.1 MDLLSFSSSTATSQFSSEKPTLSHHHHQNPTSFFPFSFKHITPSSPKLSPLKTSLKSSKTLTPIPQLDAPQTPATSMRGAETDTMGLLLRERIVFLGNSI DDFVADAIISQLLLLDAQDPTKDIRLFINCPGGSPSATMAIYDVVQLVRADVSTVALGIAASTASIILGGGTKGKRFAMPNTRIMIHQPLGGASGQAINV EIQARELCKTRIM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G45390		NCLPP3, NCLPP4,...	NUCLEAR-ENCODED CLP PROTEASE P...		Potri.001G130601 [exp]	0	1
AT5G13640		PDAT1, ATPDAT	PHOSPHOLIPID:DIACYLGLYCEROL AC...		Potri.001G171000 [exp]	4.47	0.8165	Pt-ATPDAT.2
AT3G10110		MEE67	maternal effect embryo arrest ...		Potri.001G281200 [exp]	14.00	0.7641
AT5G10730			NAD(P)-binding Rossmann-fold s...		Potri.006G268000 [exp]	18.76	0.7426
AT4G39120		HISN7, IMPL2	HISTIDINE BIOSYNTHESIS 7, myo-...		Potri.009G120600 [exp]	20.29	0.8059
AT1G09600			Protein kinase superfamily pro...		Potri.003G003700 [exp]	20.83	0.7308
AT5G08290		YLS8	YELLOW-LEAF-SPECIFIC GENE 8, m...		Potri.007G072700 [exp]	22.24	0.7306
					Potri.017G044550 [exp]	22.44	0.7995
AT3G13470		Cpn60beta2	chaperonin-60beta2, TCP-1/cpn6...		Potri.003G222400 [exp]	24.37	0.7660	Pt-LEN1.1
AT2G25620		AtDBP1	DNA-binding protein phosphatas...		Potri.018G115100 [exp]	27.54	0.7078
AT5G51700		ATRAR1, RPR2, P...	Required for Mla12 resistance ...		Potri.015G132300 [exp]	28.77	0.7389	PBS2.1

Compare expression of checked genes

Potri.001G130601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.