Potri.001G133600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45590 105 / 3e-29 Ribosomal protein L35 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G099900 176 / 4e-57 AT5G45590 134 / 2e-40 Ribosomal protein L35 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010406 117 / 7e-34 AT5G45590 147 / 1e-45 Ribosomal protein L35 (.1)
Lus10010409 117 / 7e-34 AT5G45590 147 / 1e-45 Ribosomal protein L35 (.1)
Lus10012140 99 / 1e-26 AT5G45590 148 / 7e-46 Ribosomal protein L35 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01632 Ribosomal_L35p Ribosomal protein L35
Representative CDS sequence
>Potri.001G133600.1 pacid=42790393 polypeptide=Potri.001G133600.1.p locus=Potri.001G133600 ID=Potri.001G133600.1.v4.1 annot-version=v4.1
ATGCAGAGATTGTGCACAAAGCTTCGATCTTTAGCCTCTGTTTCCTCCTCACATCGCCTTCTCCACTCGTCTCCGCAATTTTATCACCGACCTCTCCATT
TCGCCGCTGCTTCAAGTAAATGGAGTCTTAATGGGTCCCTTTTGAACACATCTTCTTCGTTACCAATTCAGCTTCCTTCGCTACCATTTCTTCCCTCTTT
TCGTCTGTCTCCACTCTCCGACCCTTTGGTGCAAGTGCGTCATGTTTCATCAAGGGAGCGGAAAAAGAATAGGAAGCCAATGACTCCACTCACCTCCAAA
GTCAAAAAGTTTAAAATGAAGGCTTACTCGTCGTATAAGGACAGGTTTAGGACAATGAATGATGGGACTATTCGTCGCTGGAGGGAGGGCAAGAATCATA
ATGCGCACTTGAAGTCAAAGAAATCAAGACGTAGACTTAGACAACCATCTACTGTCCCTGCAGCCTATGCCAAAGTCATGAAGAAGCTTAGTTTCTGTGT
TTAA
AA sequence
>Potri.001G133600.1 pacid=42790393 polypeptide=Potri.001G133600.1.p locus=Potri.001G133600 ID=Potri.001G133600.1.v4.1 annot-version=v4.1
MQRLCTKLRSLASVSSSHRLLHSSPQFYHRPLHFAAASSKWSLNGSLLNTSSSLPIQLPSLPFLPSFRLSPLSDPLVQVRHVSSRERKKNRKPMTPLTSK
VKKFKMKAYSSYKDRFRTMNDGTIRRWREGKNHNAHLKSKKSRRRLRQPSTVPAAYAKVMKKLSFCV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G45590 Ribosomal protein L35 (.1) Potri.001G133600 0 1
AT1G14685 BBR_BPC BBR/BPC2, ATBPC... basic pentacysteine 2 (.1.2.3) Potri.015G032900 2.82 0.8676 Pt-GBP.7
AT2G34470 PSKF109, UREG urease accessory protein G (.1... Potri.002G243500 5.65 0.8504 Pt-EU3.2
AT1G30910 Molybdenum cofactor sulfurase ... Potri.003G154900 10.39 0.8270
AT1G11120 unknown protein Potri.019G103800 11.40 0.8042
AT1G44835 YbaK/aminoacyl-tRNA synthetase... Potri.005G175900 13.56 0.7694
AT5G06160 ATO ATROPOS, splicing factor-relat... Potri.012G012800 13.71 0.8085
AT5G55125 Ribosomal protein L31 (.1.2) Potri.001G314100 15.96 0.7186
AT4G24040 TREHALASE1, ATT... trehalase 1 (.1) Potri.001G087100 16.49 0.7934
AT2G27490 ATCOAE dephospho-CoA kinase family (.... Potri.008G053601 17.83 0.8027
AT3G29280 unknown protein Potri.017G090400 19.74 0.7807

Potri.001G133600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.