Plant FIBer expression Database

DAD1.2 (Potri.001G136800) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol DAD1.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G35520 203 / 3e-69 DAD2 DEFENDER AGAINST CELL DEATH 2, Defender against death (DAD family) protein (.1), Defender against death (DAD family) protein (.2)
AT1G32210 202 / 5e-69 ATDAD1 DEFENDER AGAINST APOPTOTIC DEATH 1, Defender against death (DAD family) protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G096800
[exp]
216 / 3e-74 AT1G32210 213 / 2e-73 DEFENDER AGAINST APOPTOTIC DEATH 1, Defender against death (DAD family) protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010413
[exp]
206 / 2e-70 AT1G32210 207 / 6e-71 DEFENDER AGAINST APOPTOTIC DEATH 1, Defender against death (DAD family) protein (.1)
Lus10012136
[exp]
204 / 1e-69 AT1G32210 208 / 2e-71 DEFENDER AGAINST APOPTOTIC DEATH 1, Defender against death (DAD family) protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02109 DAD DAD family
Representative CDS sequence
>Potri.001G136800.1 pacid=42789484 polypeptide=Potri.001G136800.1.p locus=Potri.001G136800 ID=Potri.001G136800.1.v4.1 annot-version=v4.1
ATGGGGAGAACTACCAGCAAAGACGCACAAGCACTCATTCATTCCCTTTGTTCTGCTTATGCTGCCACTCCTACTAGCCTTAAGATCATCGATCTGTATG
TGGGTTTTGCAGTTTTCGCTGCTATAATTCAGGTAGTTTACATGGCCATTGTTGGGTCATTTCCGTTCAACTCTTTTCTCTCTGGAGTACTTTCTTGTAT
TGGGACTGCAGTCCTTGCTGTTTGTCTCCGTATCCAAGTGAACAAGGAAAACAAGGAATTCAAGGATTTACCACCAGAGCGTGCCTTTGCTGATTTTGTT
TTGTGCAATTTGGTGCTCCATTTGGTGATTATGAATTTCCTAGGTTAA
AA sequence
>Potri.001G136800.1 pacid=42789484 polypeptide=Potri.001G136800.1.p locus=Potri.001G136800 ID=Potri.001G136800.1.v4.1 annot-version=v4.1
MGRTTSKDAQALIHSLCSAYAATPTSLKIIDLYVGFAVFAAIIQVVYMAIVGSFPFNSFLSGVLSCIGTAVLAVCLRIQVNKENKEFKDLPPERAFADFV
LCNLVLHLVIMNFLG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G35520 DAD2 DEFENDER AGAINST CELL DEATH 2,... Potri.001G136800
[exp]
0 1 DAD1.2
AT1G78060 Glycosyl hydrolase family prot... Potri.005G168500
[exp]
8.00 0.8643
AT5G32450 RNA binding (RRM/RBD/RNP motif... Potri.019G037600
[exp]
21.21 0.8711
AT1G11680 EMB1738, CYP51A... embryo defective 1738, CYTOCHR... Potri.003G161700
[exp]
24.53 0.8661 CYP51G5,CYP51.1
AT5G55190 RAN3, ATRAN3 RAN GTPase 3 (.1) Potri.018G030900
[exp]
25.78 0.8244
AT4G08685 SAH7 Pollen Ole e 1 allergen and ex... Potri.005G167900
[exp]
28.98 0.8739 Pt-SAH7.2
AT2G33040 ATP3 gamma subunit of Mt ATP syntha... Potri.012G066100
[exp]
38.49 0.8753 ATPC.1
AT3G54650 FBL17 RNI-like superfamily protein (... Potri.005G218400
[exp]
39.11 0.8474
AT2G32060 Ribosomal protein L7Ae/L30e/S1... Potri.002G056200
[exp]
40.29 0.8711 Pt-RPS12.2
AT1G20575 DPMS1 dolichol phosphate mannose syn... Potri.005G250900
[exp]
40.49 0.8108
AT3G59540 Ribosomal L38e protein family ... Potri.010G181200
[exp]
41.64 0.8639 Pt-RPL38.2

Potri.001G136800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.