Potri.001G137900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G35490 301 / 3e-100 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT4G22240 208 / 7e-65 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT4G04020 201 / 9e-62 FIB fibrillin (.1)
AT3G26070 44 / 0.0001 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT3G26080 41 / 0.0005 plastid-lipid associated protein PAP / fibrillin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G095900 405 / 3e-141 AT2G35490 334 / 5e-113 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.004G003200 213 / 2e-66 AT4G22240 380 / 1e-132 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.001G209600 46 / 1e-05 AT3G26070 253 / 7e-85 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.003G020700 42 / 0.0005 AT3G26070 244 / 6e-81 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035384 304 / 2e-101 AT2G35490 357 / 5e-122 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10030987 302 / 8e-101 AT2G35490 354 / 5e-121 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10001099 205 / 3e-63 AT4G22240 362 / 5e-126 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10014790 199 / 8e-61 AT4G22240 363 / 2e-126 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10020982 41 / 0.0008 AT3G26070 265 / 1e-89 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04755 PAP_fibrillin PAP_fibrillin
Representative CDS sequence
>Potri.001G137900.1 pacid=42789368 polypeptide=Potri.001G137900.1.p locus=Potri.001G137900 ID=Potri.001G137900.1.v4.1 annot-version=v4.1
ATGGCACTCTTCTTCACCTCACACTCCTCCCTCTTCCTCTCCCCTTCGTCTTCCATAAACCCCAACAACCCATTCCCTCTCTCCAAATCCCCACAACTAC
CATCCCTATCTTTCTCCTGCAAATCCTCTAAAACTCTCCGTTTCCATCCCCAAATTACTAAACAACCCAGATTCCCTACCCACCTCACACGCACCTCCTC
CTCTGTTCCGTCATCTGACCCGGATCCGGAACCAAACCCAACTCCAGTAAGTATCACTGACGAGTGGGGCGAGAAGGCAGAGCCCGAGCCCGAGTACCCG
AAAGATGCGGACTCGGATCCTACGAGAAATGATGACGAGTGGGGGGAGCAATTTGTTGCCGCGGGAAATGGCACCGCAGCGGCACCGAGTACCAGCAGTG
CGGTGGTCGTGGAGAAGGATGGGAGGATTGAGGATTTGAAGAGGTGTTTGGTAGATACGGTCTACGGAACGGAATTTGGGTTTCGGGCCACCCCGGAGAT
CCGGGCTGAAGTTTTAGAGCTGGTTAATCAGTTGGAGGCTGTAAACCCGACTTCGGCACCTGTGGATACTACTGGTGTGCTCGATGGAAAATGGGTCTTG
GTGTATACTGCATTTTCTGAACTGTTGCCACTTCTGGCAGCAGGTGCTACACCTTTATTGAAAGTGAAAAGCATATCTCAAACAATTGATTCCAGCAATC
TATCTATTGTGAACTCAACTACATTGTCAAGCCCTTTTGCTACTTTCTCTTTTAGCGCATCTGCAACTTTTGAGGTTCGGACTCCTTCAAGAATACAGGT
TGAATTTAAGGAAGGTACACTGCAACCTCCGGAAATAAATTCCAACATAGATCTCCCAGAAAATGTTGAACTATTTGGGCAAAAGATCAATTTGTCTCCT
GTCCAGCAATCTCTCAATCCTCTGCAGGAGGCAGCAGCAAATATTGGAAGAACCATTTCTGGCCAGCCACCACTTAAGGTACCCATTCCAGGCAAACAAG
CAAGCTCCTGGCTTCTTATTACCTACCTTGATGAGGATCTCCGTATCTCAAGAGGGGATGGTGGTCTTTTTGTTCTTGCTAAAGAAGGAAGTCCTCTTCT
AGAACTGTAG
AA sequence
>Potri.001G137900.1 pacid=42789368 polypeptide=Potri.001G137900.1.p locus=Potri.001G137900 ID=Potri.001G137900.1.v4.1 annot-version=v4.1
MALFFTSHSSLFLSPSSSINPNNPFPLSKSPQLPSLSFSCKSSKTLRFHPQITKQPRFPTHLTRTSSSVPSSDPDPEPNPTPVSITDEWGEKAEPEPEYP
KDADSDPTRNDDEWGEQFVAAGNGTAAAPSTSSAVVVEKDGRIEDLKRCLVDTVYGTEFGFRATPEIRAEVLELVNQLEAVNPTSAPVDTTGVLDGKWVL
VYTAFSELLPLLAAGATPLLKVKSISQTIDSSNLSIVNSTTLSSPFATFSFSASATFEVRTPSRIQVEFKEGTLQPPEINSNIDLPENVELFGQKINLSP
VQQSLNPLQEAAANIGRTISGQPPLKVPIPGKQASSWLLITYLDEDLRISRGDGGLFVLAKEGSPLLEL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G35490 Plastid-lipid associated prote... Potri.001G137900 0 1
AT2G36000 EMB3114 EMBRYO DEFECTIVE 3114, Mitocho... Potri.016G072200 1.00 0.9902
AT3G08740 elongation factor P (EF-P) fam... Potri.016G136600 1.41 0.9882
AT5G57345 unknown protein Potri.006G165800 3.00 0.9843
AT3G20680 Domain of unknown function (DU... Potri.011G132500 3.16 0.9832
AT3G58830 haloacid dehalogenase (HAD) su... Potri.002G060600 5.29 0.9825
AT1G74970 TWN3, RPS9 ribosomal protein S9 (.1) Potri.002G132200 5.65 0.9839 Pt-RPS9.2
AT1G68590 Ribosomal protein PSRP-3/Ycf65... Potri.010G127300 6.32 0.9804
AT3G54210 Ribosomal protein L17 family p... Potri.006G113500 7.74 0.9831
AT5G65840 Thioredoxin superfamily protei... Potri.014G012100 7.93 0.9795
AT4G27990 ATYLMG1-2 YGGT family protein (.1) Potri.002G250200 8.66 0.9762

Potri.001G137900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.