Potri.001G138300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G35470 79 / 4e-19 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G095500 184 / 3e-60 AT2G35470 87 / 5e-22 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030980 55 / 5e-10 AT2G35470 81 / 7e-20 unknown protein
Lus10035375 55 / 6e-10 AT2G35470 89 / 8e-23 unknown protein
PFAM info
Representative CDS sequence
>Potri.001G138300.4 pacid=42792098 polypeptide=Potri.001G138300.4.p locus=Potri.001G138300 ID=Potri.001G138300.4.v4.1 annot-version=v4.1
ATGCAAAGACAATCTCTAGGCCCACCAGTAACCAAGCTCCACCCCCATGGAGGAGCCGATACTCTCTTATCAAACGACACTAAACCAGTATTCAAAGACC
TGCCTCCTTCTACTTCACTCGCACCCGACGCTGACGACTTAGATCACAAATCAACAAAACCACGCCGATTCTTTTCTTCTTCATCCGTACTTTCACCTGC
GCCTCCAAAACCAGAGAAACTCATTCACCTTATTCCTTTCCTCACCCTCTTTTGTTTCCTTGTCCTCTTCCTTGTCTCCCATACTCCTTCTCAATCAGAT
TTGGCTCAGTTTAATGGATTCTCTAACCATATAGAAGCAGCGAGTGGGAGTATTGGTGGATTAAGTGAGGTCCGAAGAGGCGATGTCTTGGCGACTCGAA
GTTTCGGAAACTTGCAAGAGATTGCTGCCGACGAACTCACCTCCCTCAAATATCGCTTTCACCGAAAACTGGCCCATTTCTAA
AA sequence
>Potri.001G138300.4 pacid=42792098 polypeptide=Potri.001G138300.4.p locus=Potri.001G138300 ID=Potri.001G138300.4.v4.1 annot-version=v4.1
MQRQSLGPPVTKLHPHGGADTLLSNDTKPVFKDLPPSTSLAPDADDLDHKSTKPRRFFSSSSVLSPAPPKPEKLIHLIPFLTLFCFLVLFLVSHTPSQSD
LAQFNGFSNHIEAASGSIGGLSEVRRGDVLATRSFGNLQEIAADELTSLKYRFHRKLAHF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G35470 unknown protein Potri.001G138300 0 1
AT3G56110 PRA1.B1 prenylated RAB acceptor 1.B1 (... Potri.008G074000 8.48 0.8174
AT1G69040 ACR4 ACT domain repeat 4 (.1.2) Potri.001G060100 8.66 0.8499
AT1G04530 TPR4 tetratricopeptide repeat 4, Te... Potri.010G065400 10.00 0.8197
AT2G29110 ATGLR2.8 glutamate receptor 2.8 (.1) Potri.018G011800 10.14 0.8522
AT1G77590 LACS9 long chain acyl-CoA synthetase... Potri.002G084100 11.48 0.7931 Pt-LACS9.3
AT3G56110 PRA1.B1 prenylated RAB acceptor 1.B1 (... Potri.008G074033 13.41 0.8139
AT4G12910 SCPL20 serine carboxypeptidase-like 2... Potri.019G054300 14.07 0.8504
AT5G25830 GATA GATA12 GATA transcription factor 12 (... Potri.013G059600 15.55 0.8032
AT2G40330 RCAR9, PYL6 regulatory components of ABA r... Potri.010G183900 17.54 0.7864
AT5G54470 CO B-box type zinc finger family ... Potri.001G414700 18.00 0.8068

Potri.001G138300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.