Potri.001G140200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G17790 379 / 2e-134 SNARE associated Golgi protein family (.1)
AT1G71940 330 / 6e-115 SNARE associated Golgi protein family (.1.2)
AT4G09580 311 / 4e-107 SNARE associated Golgi protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G094000 452 / 2e-163 AT4G17790 378 / 8e-134 SNARE associated Golgi protein family (.1)
Potri.013G113000 329 / 2e-114 AT4G09580 454 / 5e-163 SNARE associated Golgi protein family (.1)
Potri.019G083500 327 / 3e-113 AT1G71940 460 / 1e-165 SNARE associated Golgi protein family (.1.2)
Potri.008G202600 45 / 2e-05 AT5G19070 338 / 1e-117 SNARE associated Golgi protein family (.1)
Potri.010G030800 43 / 8e-05 AT5G19070 321 / 7e-111 SNARE associated Golgi protein family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004564 388 / 9e-138 AT4G17790 388 / 1e-137 SNARE associated Golgi protein family (.1)
Lus10000905 387 / 1e-137 AT4G17790 387 / 2e-137 SNARE associated Golgi protein family (.1)
Lus10017913 320 / 1e-110 AT4G09580 442 / 2e-158 SNARE associated Golgi protein family (.1)
Lus10014818 281 / 6e-96 AT1G71940 374 / 2e-132 SNARE associated Golgi protein family (.1.2)
Lus10034028 50 / 5e-07 AT5G19070 363 / 3e-127 SNARE associated Golgi protein family (.1)
Lus10004421 49 / 1e-06 AT5G19070 361 / 2e-126 SNARE associated Golgi protein family (.1)
Lus10021942 47 / 5e-06 AT5G19070 343 / 9e-120 SNARE associated Golgi protein family (.1)
Lus10028016 47 / 6e-06 AT1G03260 328 / 2e-113 SNARE associated Golgi protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09335 SNARE_assoc SNARE associated Golgi protein
Representative CDS sequence
>Potri.001G140200.1 pacid=42790615 polypeptide=Potri.001G140200.1.p locus=Potri.001G140200 ID=Potri.001G140200.1.v4.1 annot-version=v4.1
ATGAAGGGAAAAGGAGGACATGTGGGATCCAGATTTCCTTTGAGCTCTTGGGAGGTTGCTGCTGCTTCCTCTGTTCTGTTGGGATTCGTTCTGGGTCTTT
TGGGGGTTTACCTAACCATGCCTGAATCTGATTACAGTTTCCTCAAGCTCCCTCGCACCCTTGAAGATCTTCAAATCCTCAGGGATCACCTTGAAACTTA
TACAAGTGACTACACTGCACAAGTCCTGGTGGGATACTGTGTGGTCTACATTTTCATGCAGACTTTTATGATCCCTGGCACTGTTTTTATGTCATTGCTT
GCTGGGGCTCTTTTTGGAGTATTTAAAGGTGTAGCTTTGGTGGTGTTCACTGCCACTGCTGGTGCTTCTTCTTGCTATTTCCTGTCAAAATTAATCGGGC
GCCCTCTTGTCTTCAGTCTCTGGCCTGACAAGCTTAGTTTCTTCCAAGAGCAGGTGGCTAGAAGAAGAGGAGGATTGTTGAACTACATGCTTTTCTTAAG
ACTAACCCCAACTTTACCAAATACATTTATTAATGTTGCTTCACCAATAGTTGATGTTCCTTATCACATTTTCTTCCTGGCAACCTTGATCGGACTTGTT
CCTGCTGCTTATGTCACTGTTAAGGCTGGAATAGCTCTTGGAGAATTGCAATCTATAGGCGATCTTTATGACTTCAACTCCATTGCCACTCTATTCCTCA
TCGGGATTGTTTCTATTACCCCTACATTAATAAGCAAGAGTAAATCATAG
AA sequence
>Potri.001G140200.1 pacid=42790615 polypeptide=Potri.001G140200.1.p locus=Potri.001G140200 ID=Potri.001G140200.1.v4.1 annot-version=v4.1
MKGKGGHVGSRFPLSSWEVAAASSVLLGFVLGLLGVYLTMPESDYSFLKLPRTLEDLQILRDHLETYTSDYTAQVLVGYCVVYIFMQTFMIPGTVFMSLL
AGALFGVFKGVALVVFTATAGASSCYFLSKLIGRPLVFSLWPDKLSFFQEQVARRRGGLLNYMLFLRLTPTLPNTFINVASPIVDVPYHIFFLATLIGLV
PAAYVTVKAGIALGELQSIGDLYDFNSIATLFLIGIVSITPTLISKSKS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G17790 SNARE associated Golgi protein... Potri.001G140200 0 1
AT1G60420 DC1 domain-containing protein ... Potri.002G017200 1.41 0.9082
AT5G24080 Protein kinase superfamily pro... Potri.015G026300 2.82 0.8878
AT3G08720 ATPK2, ATPK19, ... ARABIDOPSIS THALIANA SERINE/TH... Potri.006G109600 4.58 0.8523 Pt-ATPK19.1
AT2G46680 HD ATHB7, ATHB-7 ARABIDOPSIS THALIANA HOMEOBOX ... Potri.014G103000 4.89 0.8769 Pt-ATHB.5
AT4G21440 MYB ATMYB102, ATM4 A. THALIANA MYB 4, MYB-like 10... Potri.011G041600 6.92 0.8672
AT1G72510 Protein of unknown function (D... Potri.006G219100 7.54 0.8785
AT5G40390 RS5, SIP1 seed imbibition 1-like, raffin... Potri.017G036700 9.21 0.8743 Pt-RFS.3
AT4G18170 WRKY ATWRKY28, WRKY2... WRKY DNA-binding protein 28 (.... Potri.005G203200 12.00 0.8347
AT1G45249 bZIP AtABF2, ATAREB1... ABSCISIC ACID RESPONSIVE ELEME... Potri.002G125400 15.90 0.8050 ABF2.2
AT5G47560 ATTDT, ATSDAT tonoplast dicarboxylate transp... Potri.006G013900 16.12 0.8116

Potri.001G140200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.