Potri.001G140500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G17940 196 / 6e-62 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G32340 118 / 5e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G20190 117 / 6e-31 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G80130 111 / 1e-28 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G04530 96 / 5e-23 TPR4 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G29670 77 / 9e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G07280 74 / 8e-15 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
AT3G47080 65 / 8e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G068200 123 / 4e-33 AT5G20190 167 / 6e-50 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G254300 121 / 4e-33 AT4G32340 157 / 2e-47 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G256900 121 / 6e-32 AT4G17940 125 / 2e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.018G130300 119 / 6e-32 AT5G20190 166 / 2e-49 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.018G130100 118 / 2e-31 AT5G20190 180 / 5e-55 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.008G172200 112 / 3e-28 AT1G04530 137 / 1e-36 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G065400 108 / 4e-27 AT1G04530 160 / 5e-46 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G250100 79 / 3e-16 AT2G29670 499 / 5e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.009G044200 76 / 2e-15 AT2G29670 484 / 5e-166 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002166 124 / 1e-33 AT5G20190 192 / 8e-60 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10030103 121 / 2e-32 AT5G20190 179 / 1e-54 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10024949 122 / 6e-32 AT4G17940 125 / 8e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10022877 118 / 4e-31 AT4G17940 121 / 5e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10014468 119 / 2e-30 AT1G04530 177 / 1e-51 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10023721 119 / 2e-30 AT1G04530 171 / 4e-49 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10000257 118 / 4e-30 AT1G04530 179 / 3e-52 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10002013 114 / 1e-29 AT4G32340 152 / 5e-45 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10028155 106 / 7e-29 AT4G17940 106 / 3e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10043266 102 / 1e-25 AT5G20190 162 / 1e-48 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.001G140500.1 pacid=42791621 polypeptide=Potri.001G140500.1.p locus=Potri.001G140500 ID=Potri.001G140500.1.v4.1 annot-version=v4.1
ATGAAATCTGTTCCACTGAGAACCGGTTCATTTCCGATCCAATCAACGGTTCGGCCAGGCTCACCTAAAATCTCTCTAACACGTTACGATTCACCGACTA
ACATCTTCTCCGGTGTTAGTTCTCCGAGAGATTCGCTGCATTTGGATATCAATCATCACCAGACAGGAGCTCCGATTCGGAGGGCGTTGTCGGAGAGTAA
TGTCATCAGATCGGAGAGGGAGGCTTCCAGAGGGCTGAAGAAGCCTTCCGGTGCTGGTTCGCGGTCTTTTCCGTCGATGATACCAGAGGTCGAGGAGCAT
GTGTTTGGGGACAGGGTGGATGATTACGCTGGAATCTGGCCGAAGAGCGGGATTCCATTGGAGGAGTTAGGTTTTTCCGGAGACGGATTCGGTAAATCCT
CCGGCGGACATGGGGGAAACGGCCGACATGGGAGAAGCGGCGGTGATGATGTTAGCAAGATGGGTGATTATTATAAGCAAATGTTGAAGTCAAACCCCAA
CGATGCTTTGATTCTAAGAAACTACGGAAAATACTTACACGAGGTGGAGGGAGACGCGGAGAAAGCAGAGGAGTACTACGGGAGAGCAATATTGGCGAGT
CCAGGAGACGGAGAGGTGTTGTCTTTGTATGGGAAATTAATTTGGGATGCAAAAAGGGATGGGGAGAGAGCTAAATCTTACTTTGATCAAGCTGTTTTCG
CCTCTCCTAATGATTGCATGGTATTGGGATCGTATGCAAGTTTTATGTGGGAGGCAGAGGAAGGCGGTGAAGAGGAGGAGGAGGACAAGAGTGAAGTGTC
ATCAGCAGCGGCCATGGTTGCTGCATTTTAG
AA sequence
>Potri.001G140500.1 pacid=42791621 polypeptide=Potri.001G140500.1.p locus=Potri.001G140500 ID=Potri.001G140500.1.v4.1 annot-version=v4.1
MKSVPLRTGSFPIQSTVRPGSPKISLTRYDSPTNIFSGVSSPRDSLHLDINHHQTGAPIRRALSESNVIRSEREASRGLKKPSGAGSRSFPSMIPEVEEH
VFGDRVDDYAGIWPKSGIPLEELGFSGDGFGKSSGGHGGNGRHGRSGGDDVSKMGDYYKQMLKSNPNDALILRNYGKYLHEVEGDAEKAEEYYGRAILAS
PGDGEVLSLYGKLIWDAKRDGERAKSYFDQAVFASPNDCMVLGSYASFMWEAEEGGEEEEEDKSEVSSAAAMVAAF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G17940 Tetratricopeptide repeat (TPR)... Potri.001G140500 0 1
AT5G40010 ASD, AATP1 ATPase-in-Seed-Development, AA... Potri.013G047900 5.09 0.7778
AT4G14540 CCAAT NF-YB3 "nuclear factor Y, subunit B3"... Potri.005G083400 19.44 0.7297
AT1G15000 SCPL50 serine carboxypeptidase-like 5... Potri.008G129850 25.88 0.7310
AT3G09010 Protein kinase superfamily pro... Potri.011G049600 30.00 0.6909
AT1G24530 Transducin/WD40 repeat-like su... Potri.010G050900 35.14 0.7031
AT3G49290 ABIL2 ABL interactor-like protein 2 ... Potri.001G088100 43.56 0.7112
AT1G53900 Eukaryotic translation initiat... Potri.001G163300 54.91 0.6949
AT4G07410 PCN POPCORN, Transducin family pro... Potri.002G117500 66.82 0.6791
AT2G39840 TOPP4 type one serine/threonine prot... Potri.019G018000 67.76 0.6488
AT5G23850 Arabidopsis thaliana protein o... Potri.003G125000 74.24 0.6836

Potri.001G140500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.