Potri.001G142700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G35290 105 / 4e-30 unknown protein
AT1G17345 38 / 0.0004 SAUR-like auxin-responsive protein family (.1)
AT1G72430 37 / 0.001 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G091400 224 / 3e-77 AT2G35290 112 / 7e-33 unknown protein
Potri.006G137000 38 / 0.0003 AT5G20820 135 / 3e-42 SAUR-like auxin-responsive protein family (.1)
Potri.003G071000 38 / 0.0004 AT1G72430 126 / 9e-39 SAUR-like auxin-responsive protein family (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.001G142700.1 pacid=42791937 polypeptide=Potri.001G142700.1.p locus=Potri.001G142700 ID=Potri.001G142700.1.v4.1 annot-version=v4.1
ATGGATTGCTTGGTCTTGCCTGTATCAATGTTGAGAAAGTGCTGCACGAGGTCACGACCAGGTTATCGTCCATTAACTGAAGATGGGTTCAGCGATTTGG
ATAGTCCGGTGACTGTGGTGGTGGGAAAAGAGATGAAAGAGTTCTTGGTCGATCCGTTTGTACTAGAAGAGAGCCCCTTTCGGGTTTTGATAGAAACAGT
CAGAAAGGATAATATTTTTTATGATATTACGAGTAGATCAAGGGAGGAGAAGAAAGTGATTTTTGTGGATGTGGATGCCATTTTGTTCGAGCATATGCTG
TGGTTGATGTACAATGATTCTTCTTCTCTATTTCAGCTTAATCTCAAGGAGATTATTGACTTCTACGCTCAAGATTGTTAG
AA sequence
>Potri.001G142700.1 pacid=42791937 polypeptide=Potri.001G142700.1.p locus=Potri.001G142700 ID=Potri.001G142700.1.v4.1 annot-version=v4.1
MDCLVLPVSMLRKCCTRSRPGYRPLTEDGFSDLDSPVTVVVGKEMKEFLVDPFVLEESPFRVLIETVRKDNIFYDITSRSREEKKVIFVDVDAILFEHML
WLMYNDSSSLFQLNLKEIIDFYAQDC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G35290 unknown protein Potri.001G142700 0 1
AT1G77940 Ribosomal protein L7Ae/L30e/S1... Potri.005G080700 7.28 0.9327
AT3G49010 RSU2, ATBBC1 40S RIBOSOMAL PROTEIN, breast ... Potri.016G082300 9.16 0.9270
AT1G15250 Zinc-binding ribosomal protein... Potri.018G036900 14.83 0.9235
AT1G01100 60S acidic ribosomal protein f... Potri.015G004700 16.43 0.9175
AT3G04400 EMB2171 embryo defective 2171, Ribosom... Potri.003G136400 16.97 0.9053
AT5G25757 RNA polymerase I-associated fa... Potri.018G038500 17.66 0.9047
AT3G05590 RPL18 ribosomal protein L18 (.1) Potri.014G127300 18.24 0.9239 RPL18.10
AT3G53020 RPL24B, STV1 SHORT VALVE1, Ribosomal protei... Potri.003G123101 21.67 0.9180
AT2G47510 FUM1 fumarase 1 (.1.2) Potri.002G201300 22.73 0.8776 FUM1.1
AT3G04840 Ribosomal protein S3Ae (.1) Potri.008G156300 31.41 0.9137 RS3.2

Potri.001G142700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.