Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G32440 63 / 1e-12 ATKAO2, CYP88A4, KAO2 ARABIDOPSIS ENT-KAURENOIC ACID HYDROXYLASE 2, ent-kaurenoic acid hydroxylase 2 (.1.2) AT1G05160 53 / 5e-09 ATKAO1, CYP88A3 ENT-KAURENOIC ACID OXYDASE 1, "cytochrome P450, family 88, subfamily A, polypeptide 3", cytochrome P450, family 88, subfamily A, polypeptide 3 (.1) AT5G36110 43 / 1e-05 CYP716A1 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) AT5G36140 42 / 2e-05 CYP716A2 "cytochrome P450, family 716, subfamily A, polypeptide 2", cytochrome P450, family 716, subfamily A, polypeptide 2 (.1) AT5G05690 39 / 0.0004 CBB3, DWF3, CYP90A1, CYP90A, CPD DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) AT1G73340 39 / 0.0005 Cytochrome P450 superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G179100 [exp] 64 / 8e-13 AT1G05160 741 / 0.0 ENT-KAURENOIC ACID OXYDASE 1, "cytochrome P450, family 88, subfamily A, polypeptide 3", cytochrome P450, family 88, subfamily A, polypeptide 3 (.1) Potri.013G161800 [exp] 63 / 1e-12 AT1G05160 694 / 0.0 ENT-KAURENOIC ACID OXYDASE 1, "cytochrome P450, family 88, subfamily A, polypeptide 3", cytochrome P450, family 88, subfamily A, polypeptide 3 (.1) Potri.013G106200 [exp] 45 / 2e-06 AT5G36110 492 / 2e-171 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.019G080500 [exp] 45 / 2e-06 AT5G36110 456 / 7e-158 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.013G106100 [exp] 44 / 7e-06 AT5G36110 470 / 4e-163 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.011G155600 [exp] 41 / 7e-05 AT5G36110 388 / 4e-131 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.019G078600 [exp] 41 / 7e-05 AT5G36110 476 / 2e-165 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.001G003000 [exp] 40 / 0.0001 AT5G36110 389 / 3e-131 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.001G003100 [exp] 38 / 0.0007 AT5G36110 424 / 2e-145 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000026 [exp] 58 / 1e-11 AT2G32440 89 / 2e-21 ARABIDOPSIS ENT-KAURENOIC ACID HYDROXYLASE 2, ent-kaurenoic acid hydroxylase 2 (.1.2) Lus10043357 [exp] 59 / 3e-11 AT2G32440 643 / 0.0 ARABIDOPSIS ENT-KAURENOIC ACID HYDROXYLASE 2, ent-kaurenoic acid hydroxylase 2 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G144933.1 pacid=42790498 polypeptide=Potri.001G144933.1.p locus=Potri.001G144933 ID=Potri.001G144933.1.v4.1 annot-version=v4.1 ATGGGGCGTGTTGTGAGCAGTGTACAAAGTTCAGTTAACCCTGTTCAGAAATGCTTCAACTCTTCTTCGTTTCTTTGTCCAATGAATACGAATGATGAAA ATGGAGTCGGACTTTTGGTGGATGATTTTCACGGCATTAATAAGTGTGTTTGTTGCAACATGGTGGTTGCTGAAGAGAGCAAATCAGTGGTTCTCTGTGA GCAGTATGCTCTCCCTCCAGGTGATATAGGTTGGCCTTTGATTGGAAATACGTGGTCATTTCTCATTTCTTTCAAATATGGCAGCCCTGACTCGTTTATT TCCAGCTTTGTTACGAGGTCTCCTCTCTTCCCCTCTCTGATCTTTCATGAGCTTACTTAA
AA sequence Show only first row Show all	>Potri.001G144933.1 pacid=42790498 polypeptide=Potri.001G144933.1.p locus=Potri.001G144933 ID=Potri.001G144933.1.v4.1 annot-version=v4.1 MGRVVSSVQSSVNPVQKCFNSSSFLCPMNTNDENGVGLLVDDFHGINKCVCCNMVVAEESKSVVLCEQYALPPGDIGWPLIGNTWSFLISFKYGSPDSFI SSFVTRSPLFPSLIFHELT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G32440		ATKAO2, CYP88A4...	ARABIDOPSIS ENT-KAURENOIC ACID...		Potri.001G144933 [exp]	0	1
					Potri.001G020250 [exp]	2.82	0.9853
					Potri.009G014750 [exp]	5.00	0.8866
					Potri.005G192050 [exp]	5.19	0.8823
					Potri.012G119350 [exp]	5.65	0.9853
AT1G68500			unknown protein		Potri.010G124700 [exp]	6.63	0.9092
					Potri.002G111832 [exp]	7.93	0.9742
					Potri.004G046401 [exp]	8.00	0.8498
					Potri.013G126450 [exp]	8.94	0.8246
AT2G28080			UDP-Glycosyltransferase superf...		Potri.009G008100 [exp]	9.89	0.9383
AT5G12260			unknown protein		Potri.012G123450 [exp]	9.94	0.9451

Compare expression of checked genes

Potri.001G144933 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.