Pt-TTM1.1 (Potri.001G145500) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-TTM1.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G32370 134 / 3e-41 TTM1, TOM2B tobamovirus multiplication 2B (.1.2.3.4)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030942 101 / 2e-28 AT1G32370 98 / 1e-27 tobamovirus multiplication 2B (.1.2.3.4)
Lus10040105 100 / 7e-28 AT1G32370 96 / 1e-26 tobamovirus multiplication 2B (.1.2.3.4)
PFAM info
Representative CDS sequence
>Potri.001G145500.1 pacid=42789114 polypeptide=Potri.001G145500.1.p locus=Potri.001G145500 ID=Potri.001G145500.1.v4.1 annot-version=v4.1
ATGTCTTCTGTCCTTGGAGAAGCAAAGCGAATGGAGAGAGCTATTGAAAGATCAGCGTCATCAGGTGGAAGTGCAAGCGCAAGAGAAGGCACAGCAAAGT
CAGTAGTGGCTGATCAAATTTCTCAAGCTGTACAATCGACCTCCAATCTCCTTCACCTTATGCAACAATCCTCTCCTTCCCAGGCCAAACTAATGAAGCT
CCCAAAGAACCTTCTGGCAAAAGCCTCTACAATCAAGAACACTGGACAAGTTTTAGACCAAATGCCTAAGGTGATCTCATCCCTGGATGCACATATGGAT
AGTGGATTACAAAGTGTTCCTCATCTGAGAACTGCAATCCAGTTACTTGCAAACATGGAGAGCTGCCAGCTTAATACTCTATCCCAAGCTCAGTTCTCTC
AACAAGAATCTGAGCCGTCAAGTCAACCTCCGGAGGCAGTTTAA
AA sequence
>Potri.001G145500.1 pacid=42789114 polypeptide=Potri.001G145500.1.p locus=Potri.001G145500 ID=Potri.001G145500.1.v4.1 annot-version=v4.1
MSSVLGEAKRMERAIERSASSGGSASAREGTAKSVVADQISQAVQSTSNLLHLMQQSSPSQAKLMKLPKNLLAKASTIKNTGQVLDQMPKVISSLDAHMD
SGLQSVPHLRTAIQLLANMESCQLNTLSQAQFSQQESEPSSQPPEAV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G32370 TTM1, TOM2B tobamovirus multiplication 2B ... Potri.001G145500 0 1 Pt-TTM1.1
AT5G10710 unknown protein Potri.018G005900 4.89 0.8354
AT4G24880 unknown protein Potri.015G095400 9.38 0.7359
AT1G55080 MED9 unknown protein Potri.003G037200 16.43 0.8344
AT1G02090 ATCSN7, COP15, ... FUSCA 5, CONSTITUTIVE PHOTOMOR... Potri.002G137400 16.73 0.7687
AT2G36330 Uncharacterised protein family... Potri.012G079800 19.44 0.7635
AT5G01160 RING/U-box superfamily protein... Potri.006G095600 25.19 0.8209
AT2G18510 EMB2444 embryo defective 2444, RNA-bin... Potri.007G028300 43.37 0.8102
AT2G01410 NHL domain-containing protein ... Potri.001G156300 44.35 0.8176
AT4G35260 IDH-I, IDH1 isocitrate dehydrogenase I, is... Potri.009G165200 44.49 0.8090
AT4G38170 FRS9 FAR1-related sequence 9 (.1) Potri.004G209100 44.83 0.7929

Potri.001G145500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.