Potri.001G145800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G35380 458 / 5e-163 Peroxidase superfamily protein (.1.2)
AT5G66390 330 / 2e-112 Peroxidase superfamily protein (.1)
AT2G18150 327 / 3e-111 Peroxidase superfamily protein (.1)
AT1G44970 324 / 7e-110 Peroxidase superfamily protein (.1)
AT4G36430 323 / 7e-110 Peroxidase superfamily protein (.1)
AT2G18140 310 / 2e-104 Peroxidase superfamily protein (.1)
AT4G16270 309 / 5e-104 Peroxidase superfamily protein (.1)
AT3G50990 308 / 1e-103 Peroxidase superfamily protein (.1)
AT5G06720 297 / 1e-99 ATPA2 peroxidase 2 (.1)
AT5G19890 288 / 6e-96 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G019300 337 / 2e-115 AT5G66390 507 / 0.0 Peroxidase superfamily protein (.1)
Potri.005G118700 332 / 4e-113 AT5G66390 504 / 0.0 Peroxidase superfamily protein (.1)
Potri.008G103200 324 / 3e-110 AT4G16270 438 / 1e-154 Peroxidase superfamily protein (.1)
Potri.002G031200 321 / 8e-109 AT1G44970 492 / 6e-176 Peroxidase superfamily protein (.1)
Potri.013G154400 300 / 5e-101 AT5G05340 363 / 3e-126 Peroxidase superfamily protein (.1)
Potri.016G132800 297 / 7e-100 AT5G05340 336 / 3e-115 Peroxidase superfamily protein (.1)
Potri.013G083600 294 / 1e-98 AT5G05340 483 / 2e-173 Peroxidase superfamily protein (.1)
Potri.006G107000 294 / 2e-98 AT5G05340 349 / 2e-120 Peroxidase superfamily protein (.1)
Potri.016G132900 293 / 4e-98 AT5G05340 350 / 6e-121 Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040107 417 / 3e-139 AT4G18010 638 / 0.0 INOSITOL\(1,4,5\)P3 5-PHOSPHATASE II, myo-inositol polyphosphate 5-phosphatase 2 (.1.2)
Lus10010634 337 / 7e-115 AT1G44970 449 / 5e-159 Peroxidase superfamily protein (.1)
Lus10041784 328 / 8e-112 AT5G66390 519 / 0.0 Peroxidase superfamily protein (.1)
Lus10029094 297 / 1e-99 AT1G68850 439 / 1e-155 Peroxidase superfamily protein (.1)
Lus10013065 296 / 3e-99 AT1G68850 431 / 2e-152 Peroxidase superfamily protein (.1)
Lus10029065 296 / 1e-98 AT5G05340 338 / 2e-115 Peroxidase superfamily protein (.1)
Lus10034207 290 / 4e-97 AT5G05340 454 / 8e-162 Peroxidase superfamily protein (.1)
Lus10017069 286 / 1e-94 AT4G16270 392 / 3e-136 Peroxidase superfamily protein (.1)
Lus10034204 285 / 2e-94 AT5G05340 336 / 9e-115 Peroxidase superfamily protein (.1)
Lus10027989 279 / 3e-92 AT5G06720 400 / 1e-139 peroxidase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.001G145800.1 pacid=42790855 polypeptide=Potri.001G145800.1.p locus=Potri.001G145800 ID=Potri.001G145800.1.v4.1 annot-version=v4.1
ATGTCATGTGATTTCTCAAGGAATCCCTTTACAATGGTCTTTATCACTTTACTGGTTTTGGTCTTGCAAAGCTTGTCGACCTTTGGTGATGAACAACTTT
TAGTCCGTGACTATTACAAGGAAACATGCCCTATGGTTGAAGAGATTGTTAGGTATAATCTTCAGTTTGCCGTGCTTAAAAATCCAAGAATGGCCGCCTC
TCTGCTTCGCTTGCATTTTCATGATTGCTTCGTTATGGGATGCGATGCATCGGTTCTTCTAGACAGCTATGGAGGCATGGTCAGTGAAAAGCAGGCAGGG
CCTAACGTGAACTCATTGCGTGGATTCGAAGTCATTGATAGGATCAAGTATCAATTGGAAGAAGCATGCCCTCTCATAGTCTCATGTGCTGATATCTTAG
CCATTGCTGCTCGTGATGCTGTTGCAGTGAGAGGTGGCCCAGGTTGGGAGGTTTATCTAGGCAGAAAGGACTCCCTCAAGGCAAGTTTTGATGGTGCCAA
TCAGTTTATACCCGCACCAAATTCCTCTCTGGAGACTCTCATTGCCAATTTTAAACAACATGGTCTTGACATAGGAGACTTGGTTGCTTTATCAGGTAGC
CACACGATGGGAAAGGCAAGATGCTTAAGCTTTAGGCAACAAATACACGATGAGAGTGCTGAAGAACATTACGATAAATACAAGAGATACACCCCCTTTC
GAAGAATCCTACGGTCCATATGTCCAAAAACAGGAAAAGACAATCAATTGGCTCCGCTTGATTTTGAAACCCCGGCTAGATTTGACAACCACTATTTCCT
CAACATTCTTGAGGGAAGAGGGTTGCTGGGGTCCGATAACGTGTTGGTGACGGAAGATCATGAGGGGGAGATAAGAAAGCAGGTGTGGGCTTATGCCTCT
GATCAAAAGCTTTTCTTCGCATCGTTTGCCAATTCTATGATAAAGATGGGGAATATTAACGTACTTTATGGGAATGAAGGAGAGGTCAGGAAGAATTGTA
GGTTTGTCAACACCTAA
AA sequence
>Potri.001G145800.1 pacid=42790855 polypeptide=Potri.001G145800.1.p locus=Potri.001G145800 ID=Potri.001G145800.1.v4.1 annot-version=v4.1
MSCDFSRNPFTMVFITLLVLVLQSLSTFGDEQLLVRDYYKETCPMVEEIVRYNLQFAVLKNPRMAASLLRLHFHDCFVMGCDASVLLDSYGGMVSEKQAG
PNVNSLRGFEVIDRIKYQLEEACPLIVSCADILAIAARDAVAVRGGPGWEVYLGRKDSLKASFDGANQFIPAPNSSLETLIANFKQHGLDIGDLVALSGS
HTMGKARCLSFRQQIHDESAEEHYDKYKRYTPFRRILRSICPKTGKDNQLAPLDFETPARFDNHYFLNILEGRGLLGSDNVLVTEDHEGEIRKQVWAYAS
DQKLFFASFANSMIKMGNINVLYGNEGEVRKNCRFVNT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G35380 Peroxidase superfamily protein... Potri.001G145800 0 1
AT3G22600 Bifunctional inhibitor/lipid-t... Potri.002G050500 1.41 0.8621
AT4G33180 alpha/beta-Hydrolases superfam... Potri.006G219400 1.73 0.8244
AT1G61820 BGLU46 beta glucosidase 46 (.1.3) Potri.004G019500 2.00 0.8372
AT3G26040 HXXXD-type acyl-transferase fa... Potri.010G054100 2.00 0.8219
AT3G03800 ATSYP131, SYP13... syntaxin of plants 131 (.1) Potri.007G123000 2.82 0.7968
AT4G31540 ATEXO70G1 exocyst subunit exo70 family p... Potri.008G008700 9.16 0.7524
AT1G61820 BGLU46 beta glucosidase 46 (.1.3) Potri.004G019700 10.19 0.7249
Potri.019G129532 12.16 0.7379
AT5G25820 Exostosin family protein (.1) Potri.006G239000 14.07 0.7674
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Potri.014G037400 15.87 0.7335

Potri.001G145800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.