Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G32410 176 / 5e-58 Vacuolar protein sorting 55 (VPS55) family protein AT3G11530 126 / 2e-38 Vacuolar protein sorting 55 (VPS55) family protein (.1), Vacuolar protein sorting 55 (VPS55) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G087500 [exp] 222 / 4e-76 AT1G32410 180 / 1e-59 Vacuolar protein sorting 55 (VPS55) family protein Potri.006G209100 [exp] 127 / 6e-39 AT3G11530 210 / 3e-72 Vacuolar protein sorting 55 (VPS55) family protein (.1), Vacuolar protein sorting 55 (VPS55) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006605 [exp] 204 / 1e-67 AT1G32410 202 / 4e-67 Vacuolar protein sorting 55 (VPS55) family protein Lus10004221 [exp] 110 / 5e-30 AT5G27720 182 / 2e-57 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10029426 [exp] 109 / 9e-29 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04133 [poplar] [flax] Vps55 Vacuolar protein sorting 55
Representative CDS sequence Show only first row Show all	>Potri.001G146600.3 pacid=42793702 polypeptide=Potri.001G146600.3.p locus=Potri.001G146600 ID=Potri.001G146600.3.v4.1 annot-version=v4.1 ATGATGCCGGACTTACCGGGTTACATGTGGGCCTGTTTACGTACTGGCAAGCTTCCTTTCTTGGCCATTTTGGTTTCTGGAGGAATTGCGTTGCAAATCT TGGCATGTGCCTTGTACAATAACTGGTGGCCGATGCTAACTGTAATAATGTACGTGCTTCTTCCAATGCCTTTGCTGTTCTATGCGGGTTCTAATAGTTC CTCACTTCTCACAGAATCTGATAGTGGTTGGGTCAATGCAACAAAGTTCCTGACCGGAGCTTCAGCAATTGGAAGCATTGCAATACCAGTTATTTTAAAG CATGCCGGTGTTATTGGATGGGGAGCGCTAGCAATGGAGCTTTCGTCATTTTTTGTATTTGTCATTGCCATAATGTGTTACATAGGCATGAGCGATGATG ATGATTACAGTATGCTCTGA
AA sequence Show only first row Show all	>Potri.001G146600.3 pacid=42793702 polypeptide=Potri.001G146600.3.p locus=Potri.001G146600 ID=Potri.001G146600.3.v4.1 annot-version=v4.1 MMPDLPGYMWACLRTGKLPFLAILVSGGIALQILACALYNNWWPMLTVIMYVLLPMPLLFYAGSNSSSLLTESDSGWVNATKFLTGASAIGSIAIPVILK HAGVIGWGALAMELSSFFVFVIAIMCYIGMSDDDDYSML

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G32410			Vacuolar protein sorting 55 (V...		Potri.001G146600 [exp]	0	1
AT3G24030			hydroxyethylthiazole kinase fa...		Potri.001G053900 [exp]	4.35	0.8361
AT5G05310			TLC ATP/ADP transporter (.1.2....		Potri.019G048700 [exp]	5.00	0.7997
AT3G07560		APM2, PEX13	ABERRANT PEROXISOME MORPHOLOGY...		Potri.017G018400 [exp]	6.92	0.7776
AT1G33500			unknown protein		Potri.013G095400 [exp]	16.06	0.8099
AT2G20740			Tetraspanin family protein (.1...		Potri.013G134200 [exp]	16.52	0.7521
AT5G25360			unknown protein		Potri.018G130900 [exp]	18.46	0.7841
AT2G18460		LCV3	like COV 3 (.1)		Potri.005G124100 [exp]	21.16	0.8003
AT1G56220			Dormancy/auxin associated fami...		Potri.013G014900 [exp]	22.13	0.7324
AT2G04845			Acyl-CoA N-acyltransferases (N...		Potri.014G161800 [exp]	23.62	0.7745
AT5G01780			2-oxoglutarate-dependent dioxy...		Potri.016G132300 [exp]	26.40	0.7499

Compare expression of checked genes

Potri.001G146600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.