Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44610 298 / 1e-103 RAB6, AtRABH1b, AtRab6A Ras-related small GTP-binding family protein (.1) AT5G10260 279 / 7e-96 AtRABH1e RAB GTPase homolog H1E (.1) AT2G22290 265 / 1e-90 ATRAB6, ATRAB-H1D, AtRABH1d ARABIDOPSIS RAB GTPASE HOMOLOG 6, ARABIDOPSIS RAB GTPASE HOMOLOG H1D, RAB GTPase homolog H1D (.1) AT4G39890 236 / 8e-79 AtRABH1c RAB GTPase homolog H1C (.1) AT5G64990 234 / 3e-78 AtRABH1a RAB GTPase homolog H1A (.1.2) AT3G54840 116 / 2e-32 ARA6, AtRABF1, Ara-6, AtRab5C Ras-related small GTP-binding family protein (.1.2) AT5G45130 111 / 2e-30 ATRAB-F2A, RHA1, AtRab5A, AtRABF2a ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) AT4G19640 109 / 2e-29 ATRAB-F2B, ARA7, Ara-7, AtRABF2b, AtRab5B ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) AT1G07410 107 / 1e-28 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT1G09630 107 / 2e-28 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G086700 [exp] 313 / 1e-109 AT2G44610 397 / 4e-143 Ras-related small GTP-binding family protein (.1) Potri.002G135500 [exp] 306 / 8e-107 AT2G44610 385 / 3e-138 Ras-related small GTP-binding family protein (.1) Potri.005G075300 [exp] 279 / 5e-96 AT5G10260 400 / 2e-144 RAB GTPase homolog H1E (.1) Potri.010G226300 [exp] 115 / 1e-31 AT3G54840 373 / 7e-134 Ras-related small GTP-binding family protein (.1.2) Potri.018G079300 [exp] 115 / 1e-31 AT5G45130 273 / 2e-94 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.008G035800 [exp] 112 / 7e-31 AT3G54840 367 / 3e-131 Ras-related small GTP-binding family protein (.1.2) Potri.012G117800 [exp] 112 / 8e-31 AT5G45130 357 / 1e-127 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.015G113000 [exp] 110 / 9e-30 AT5G45130 339 / 2e-120 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.001G270100 [exp] 107 / 1e-28 AT3G12160 379 / 2e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019501 [exp] 299 / 7e-104 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1) Lus10043349 [exp] 299 / 7e-104 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1) Lus10014336 [exp] 283 / 1e-97 AT5G10260 402 / 3e-145 RAB GTPase homolog H1E (.1) Lus10041702 [exp] 282 / 4e-97 AT5G10260 404 / 7e-146 RAB GTPase homolog H1E (.1) Lus10024046 [exp] 282 / 4e-96 AT5G10260 405 / 3e-145 RAB GTPase homolog H1E (.1) Lus10019502 [exp] 154 / 8e-48 AT2G44610 218 / 5e-74 Ras-related small GTP-binding family protein (.1) Lus10034903 [exp] 116 / 6e-32 AT5G45130 258 / 2e-88 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10028820 [exp] 113 / 5e-31 AT3G54840 354 / 3e-126 Ras-related small GTP-binding family protein (.1.2) Lus10040255 [exp] 113 / 1e-30 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10004687 [exp] 113 / 1e-30 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF08477 [poplar] [flax] Roc Ras of Complex, Roc, domain of DAPkinase
Representative CDS sequence Show only first row Show all	>Potri.001G147900.2 pacid=42793712 polypeptide=Potri.001G147900.2.p locus=Potri.001G147900 ID=Potri.001G147900.2.v4.1 annot-version=v4.1 ATGGCACCAGTCTCAGCTCTTGCAAAGTACAAGCTGGTCTTCTTGGAAGACCAATCAGTCAGTAAAACTAGCATCATCACTCGCTTCATTCAAGGAATTT CGATTATTTTCGGGGTTCTTTTTTTTTTTGATATAGAATGTGGTGCTACCATTGGCATGGATTTTCTATCAAAAACCATGTATCTTGAAGACAGAACTAT TCATTTGCAGTTGTGGGATACAGCTGGACAGGAAAGATTCAAAAGCCTCATTCCAAGTTACATTAGAGATTCCTCAGTTGCTGTCATTGTATTTGATGTT GCAAGTCGGCAATCTTTCCTGAACACTTCAAAATGGATTGAAGAGGTTCGCACTGAGAGGGGCAGCGATGTCATCATTGTCCTTGTTGGGAACAAAACCA ACCTTGTGGAAAAGAGCCACTCATTTTGGCTTGTAAATTTGTGGTCGGAACAAATACTGACAGATCTGAATTATTTGATGTTTTCCCTTTCTGCACAAGT TTCTATAGAAGAAGGAGAAGCTAAAGCTCGTGACCTTAACGTCATGTTTATCGAAACTAGTGCAAAAGCTGGTTTTAATATCAAGGCACTTTCTTCAACA AAGCAAGAGGACATGGTTGATGTGAACCTAAAGTCTTCCGGTGGAGCTTCATCTCAGACACAGCCTCAGGCAGGGGGATGTGATTGTTGA
AA sequence Show only first row Show all	>Potri.001G147900.2 pacid=42793712 polypeptide=Potri.001G147900.2.p locus=Potri.001G147900 ID=Potri.001G147900.2.v4.1 annot-version=v4.1 MAPVSALAKYKLVFLEDQSVSKTSIITRFIQGISIIFGVLFFFDIECGATIGMDFLSKTMYLEDRTIHLQLWDTAGQERFKSLIPSYIRDSSVAVIVFDV ASRQSFLNTSKWIEEVRTERGSDVIIVLVGNKTNLVEKSHSFWLVNLWSEQILTDLNYLMFSLSAQVSIEEGEAKARDLNVMFIETSAKAGFNIKALSST KQEDMVDVNLKSSGGASSQTQPQAGGCDC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G44610		RAB6, AtRABH1b,...	Ras-related small GTP-binding ...		Potri.001G147900 [exp]	0	1
AT3G06850		DIN3, LTA1, BCE...	DARK INDUCIBLE 3, 2-oxoacid de...		Potri.008G219700 [exp]	1.41	0.9605
					Potri.001G466500 [exp]	2.44	0.9534
AT4G33945			ARM repeat superfamily protein...		Potri.004G144100 [exp]	2.82	0.9596
AT1G30450		HAP5, ATCCC1, C...	HAPLESS 5, cation-chloride co-...		Potri.011G090900 [exp]	4.24	0.9468
AT1G75420			UDP-Glycosyltransferase superf...		Potri.002G031300 [exp]	5.65	0.9517
AT4G27080		ATPDI7, ATPDIL5...	ARABIDOPSIS THALIANA PROTEIN D...		Potri.011G135500 [exp]	7.07	0.9511
AT5G64180			unknown protein		Potri.015G005600 [exp]	7.41	0.9438
AT5G19320		RANGAP2	RAN GTPase activating protein ...		Potri.010G091100 [exp]	8.30	0.9344	Pt-RANGAP2.1
AT1G04430			S-adenosyl-L-methionine-depend...		Potri.002G036732 [exp]	8.94	0.9470
AT3G55440		CYTOTPI, ATCTIM...	CYTOSOLIC ISOFORM TRIOSE PHOSP...		Potri.009G031200 [exp]	10.19	0.9426

Compare expression of checked genes

Potri.001G147900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.