Plant FIBer expression Database

Potri.001G152150 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG01280 82 / 2e-20 ATCG01280.1, YCF2.2 Chloroplast Ycf2;ATPase, AAA type, core (.1)
ATCG00860 82 / 2e-20 ATCG00860.1, YCF2.1 Chloroplast Ycf2;ATPase, AAA type, core (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G143400
[exp]
91 / 2e-23 ATCG01280 3894 / 0.0 Chloroplast Ycf2;ATPase, AAA type, core (.1)
Flax homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05695 DUF825 Plant protein of unknown function (DUF825)
Representative CDS sequence
>Potri.001G152150.1 pacid=42790527 polypeptide=Potri.001G152150.1.p locus=Potri.001G152150 ID=Potri.001G152150.1.v4.1 annot-version=v4.1
ATGAAATCAGATTTTTTGAGGAACATATCGAGAGAGAATTGGATTTGGTTAGACAATGTATGGTTGGTAAACAAGGATCGGTTTTTTAGCAAGGCGTGGA
ATATATCGTCAATTATCCAATATGATTCCACAAGATCTAATTTCATTCGAGGAAGTTAA
AA sequence
>Potri.001G152150.1 pacid=42790527 polypeptide=Potri.001G152150.1.p locus=Potri.001G152150 ID=Potri.001G152150.1.v4.1 annot-version=v4.1
MKSDFLRNISRENWIWLDNVWLVNKDRFFSKAWNISSIIQYDSTRSNFIRGS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG01280 ATCG01280.1, YC... Chloroplast Ycf2;ATPase, AAA t... Potri.001G152150
[exp]
0 1
AT2G14170 ALDH6B2 aldehyde dehydrogenase 6B2 (.... Potri.005G147700
[exp]
1.41 0.8780
AT1G31870 unknown protein Potri.001G147100
[exp]
8.48 0.8127
AT1G15780 unknown protein Potri.003G013000
[exp]
12.96 0.8517
AT2G40770 zinc ion binding;DNA binding;h... Potri.019G060126
[exp]
13.63 0.8566
Potri.013G034600
[exp]
15.23 0.8076
AT5G10790 UBP22 ubiquitin-specific protease 22... Potri.006G266100
[exp]
16.79 0.7949
AT5G01270 CPL2, ATCPL2 carboxyl-terminal domain (ctd)... Potri.006G099402
[exp]
21.54 0.8479
AT5G07630 lipid transporters (.1) Potri.001G126200
[exp]
23.36 0.8292
AT2G40770 zinc ion binding;DNA binding;h... Potri.019G060300
[exp]
27.49 0.8463
AT4G36980 unknown protein Potri.005G138200
[exp]
31.93 0.8192

Potri.001G152150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.