Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47310 308 / 5e-107 PPPDE putative thiol peptidase family protein (.1) AT4G17486 293 / 4e-101 PPPDE putative thiol peptidase family protein (.1.2) AT1G47740 223 / 4e-73 PPPDE putative thiol peptidase family protein (.1.2) AT5G25170 202 / 2e-65 PPPDE putative thiol peptidase family protein (.1) AT1G80690 199 / 3e-64 PPPDE putative thiol peptidase family protein (.1) AT2G25190 199 / 5e-64 PPPDE putative thiol peptidase family protein (.1) AT4G31980 198 / 2e-59 unknown protein AT4G25680 82 / 1e-18 PPPDE putative thiol peptidase family protein (.1) AT4G25660 82 / 2e-18 PPPDE putative thiol peptidase family protein (.1) AT3G07090 67 / 5e-13 PPPDE putative thiol peptidase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G080300 [exp] 382 / 2e-136 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1) Potri.018G070600 [exp] 237 / 3e-79 AT4G17486 235 / 1e-78 PPPDE putative thiol peptidase family protein (.1.2) Potri.006G154400 [exp] 234 / 4e-78 AT4G17486 220 / 8e-73 PPPDE putative thiol peptidase family protein (.1.2) Potri.014G042300 [exp] 223 / 1e-73 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2) Potri.002G134200 [exp] 222 / 4e-73 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2) Potri.T126004 [exp] 210 / 2e-68 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2) Potri.009G113168 [exp] 209 / 7e-68 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2) Potri.004G151200 [exp] 208 / 2e-67 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2) Potri.018G021700 [exp] 203 / 9e-66 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040170 [exp] 303 / 2e-105 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2) Lus10004755 [exp] 290 / 5e-100 AT4G17486 273 / 2e-93 PPPDE putative thiol peptidase family protein (.1.2) Lus10007844 [exp] 286 / 8e-99 AT4G17486 277 / 3e-95 PPPDE putative thiol peptidase family protein (.1.2) Lus10004372 [exp] 255 / 2e-82 AT5G47310 244 / 1e-77 PPPDE putative thiol peptidase family protein (.1) Lus10013657 [exp] 244 / 4e-82 AT4G17486 243 / 1e-81 PPPDE putative thiol peptidase family protein (.1.2) Lus10043293 [exp] 243 / 3e-81 AT4G17486 243 / 3e-81 PPPDE putative thiol peptidase family protein (.1.2) Lus10019437 [exp] 238 / 4e-79 AT4G17486 241 / 1e-80 PPPDE putative thiol peptidase family protein (.1.2) Lus10033030 [exp] 233 / 5e-77 AT4G17486 225 / 3e-74 PPPDE putative thiol peptidase family protein (.1.2) Lus10032708 [exp] 225 / 3e-74 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2) Lus10003951 [exp] 224 / 1e-73 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [poplar] [flax] Peptidase_CA PF05903 [poplar] [flax] Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence Show only first row Show all	>Potri.001G154400.10 pacid=42787893 polypeptide=Potri.001G154400.10.p locus=Potri.001G154400 ID=Potri.001G154400.10.v4.1 annot-version=v4.1 ATGCGGTTGTTTCCTTTGAGCTCGAGCTCGAGTACAAGCTCGGAGAAGGAGCAGAGTAATGGAGGGAGCAGTCGTGTGATGTTGTATCTTAACATATATG ATCTTACACCTATAAATAACTACCTCTACTGGTTTGGTCTTGGGATCTTCCATTCCGGTATTGAAGTACATGGCATGGAGTATGGCTTCGGAGCCCATGA GTACCCTACCAGTGGGGTGTTTGAGGTGGAACCAAGAAGTTGTCCAGGCTTTATTTTTCGACGGTCTGTGTTATTGGGCAGCACCAACATGTCTCGATCA GAATTTCGGTCATTCATAGAACACCTGTCTGCAAAATATCATGGAGACAATTACCATTTGATTGCCAAGAATTGCAACCACTTTACTGATGAAGTCTGTA AGCGATTAACTGGAAAGCCTATTCCTGGATGGGTAAATCGGATGGCTCGATTAGTTTCAGGTTCTTTCTGTAATTGTTTACTGCCAGAAAGTATACAGAT CACAGCAGTTAGACATCTTCCAGATCATCCAACGTTTTCTGACGATGACGACGGGTTGGAATCTGTTGGATCATCTACAACATCAAGGAGCGAAGAAGAG GGTTCAAATCATCATCTGCTCACTTCACCAAATGGTGAAGTTGCATTTTTAAAGGAGAAACCAGTGAGGCTAGCAAGGGAACTCCTATAG
AA sequence Show only first row Show all	>Potri.001G154400.10 pacid=42787893 polypeptide=Potri.001G154400.10.p locus=Potri.001G154400 ID=Potri.001G154400.10.v4.1 annot-version=v4.1 MRLFPLSSSSSTSSEKEQSNGGSSRVMLYLNIYDLTPINNYLYWFGLGIFHSGIEVHGMEYGFGAHEYPTSGVFEVEPRSCPGFIFRRSVLLGSTNMSRS EFRSFIEHLSAKYHGDNYHLIAKNCNHFTDEVCKRLTGKPIPGWVNRMARLVSGSFCNCLLPESIQITAVRHLPDHPTFSDDDDGLESVGSSTTSRSEEE GSNHHLLTSPNGEVAFLKEKPVRLARELL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G47310			PPPDE putative thiol peptidase...		Potri.001G154400 [exp]	0	1
AT5G19930			Protein of unknown function DU...		Potri.018G073000 [exp]	1.73	0.8479
AT5G38360			alpha/beta-Hydrolases superfam...		Potri.004G099300 [exp]	5.47	0.8003
AT2G15830			unknown protein		Potri.009G107050 [exp]	5.65	0.8284
AT2G03500	GARP		Homeodomain-like superfamily p...		Potri.009G106600 [exp]	6.55	0.7357
AT4G16210		ECHIA, E-COAH-2	ENOYL-COA HYDRATASE 2, enoyl-C...		Potri.010G146400 [exp]	8.12	0.7572
AT1G28090			Polynucleotide adenylyltransfe...		Potri.003G164400 [exp]	13.74	0.7784
AT5G36930			Disease resistance protein (TI...		Potri.006G269950 [exp]	15.68	0.8535
AT1G12150			Plant protein of unknown funct...		Potri.006G004100 [exp]	17.00	0.7842
AT5G54680	bHLH	bHLH105, ILR3	iaa-leucine resistant3, basic ...		Potri.011G031000 [exp]	17.43	0.7885
AT1G05070			Protein of unknown function (D...		Potri.005G038000 [exp]	20.71	0.7467

Compare expression of checked genes

Potri.001G154400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.