Plant FIBer expression Database

Potri.001G156500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16695 82 / 3e-23 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G078100
[exp]
96 / 2e-28 AT4G16695 89 / 1e-25 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028968
[exp]
88 / 2e-25 AT4G16695 86 / 1e-24 unknown protein
Lus10007491
[exp]
88 / 2e-25 AT4G16695 86 / 1e-24 unknown protein
PFAM info
Representative CDS sequence
>Potri.001G156500.2 pacid=42788158 polypeptide=Potri.001G156500.2.p locus=Potri.001G156500 ID=Potri.001G156500.2.v4.1 annot-version=v4.1
ATGCCTTACAGGAGAATCATGGAGGTAGAGCCGCCGAGTCCGTTAAGGTACATAATCGGCGCAGCAATAATGATGATCGGAGTGGTGTTACCCGTCGGTT
ACATGATGTTTCGTAACAAGAGGGGTCCTTCTTCTTCTTCCACTTACTCCAAACAGACGTAG
AA sequence
>Potri.001G156500.2 pacid=42788158 polypeptide=Potri.001G156500.2.p locus=Potri.001G156500 ID=Potri.001G156500.2.v4.1 annot-version=v4.1
MPYRRIMEVEPPSPLRYIIGAAIMMIGVVLPVGYMMFRNKRGPSSSSTYSKQT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G16695 unknown protein Potri.001G156500
[exp]
0 1
AT4G08240 unknown protein Potri.002G086200
[exp]
2.00 0.8692
AT3G01390 AVMA10, VMA10 vacuolar membrane ATPase 10 (.... Potri.008G040300
[exp]
8.00 0.8870 Pt-VMA10.1
AT2G17265 DMR1, HSK DOWNY MILDEW RESISTANT 1, homo... Potri.004G207000
[exp]
8.66 0.8461 HSK.1
AT1G27970 NTF2B nuclear transport factor 2B (.... Potri.003G170800
[exp]
8.77 0.7937 Pt-NTF2.1
AT5G55290 ATPase, V0 complex, subunit E ... Potri.011G092600
[exp]
9.00 0.8565
AT1G49140 Complex I subunit NDUFS6 (.1) Potri.012G056900
[exp]
12.00 0.8824
AT5G45130 ATRAB-F2A, RHA1... ARABIDOPSIS RAB HOMOLOG F2A, R... Potri.015G113000
[exp]
13.96 0.8223 ARA7.2
AT5G15770 ATGNA1 glucose-6-phosphate acetyltran... Potri.018G086400
[exp]
17.46 0.8681
AT2G21190 ER lumen protein retaining rec... Potri.009G128900
[exp]
18.33 0.8653
AT1G26550 FKBP-like peptidyl-prolyl cis-... Potri.008G089900
[exp]
19.07 0.8334

Potri.001G156500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.