Potri.001G158000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16600 678 / 0 Nucleotide-diphospho-sugar transferases superfamily protein (.1)
AT2G35710 677 / 0 Nucleotide-diphospho-sugar transferases superfamily protein (.1.2.3)
AT5G18480 117 / 6e-28 PGSIP6 plant glycogenin-like starch initiation protein 6 (.1)
AT1G08990 78 / 4e-15 PGSIP5 plant glycogenin-like starch initiation protein 5 (.1)
AT1G54940 69 / 3e-12 PGSIP4 plant glycogenin-like starch initiation protein 4 (.1)
AT4G33330 64 / 9e-11 PGSIP3, GUX2 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
AT1G77130 62 / 4e-10 PGSIP2, GUX3 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
AT3G18660 61 / 9e-10 PGSIP1, GUX1 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
AT1G09350 49 / 4e-06 ATGOLS3 galactinol synthase 3 (.1)
AT1G56600 45 / 5e-05 ATGOLS2 galactinol synthase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G076800 852 / 0 AT4G16600 633 / 0.0 Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Potri.013G049100 108 / 3e-25 AT5G18480 661 / 0.0 plant glycogenin-like starch initiation protein 6 (.1)
Potri.005G187900 68 / 8e-12 AT1G77130 803 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Potri.014G029900 67 / 2e-11 AT4G33330 791 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
Potri.005G033500 65 / 6e-11 AT1G08990 555 / 0.0 plant glycogenin-like starch initiation protein 5 (.1)
Potri.007G107200 64 / 1e-10 AT3G18660 884 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Potri.013G022900 63 / 2e-10 AT1G08990 561 / 0.0 plant glycogenin-like starch initiation protein 5 (.1)
Potri.005G061600 62 / 3e-10 AT3G18660 863 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Potri.014G116800 54 / 8e-08 AT2G47180 568 / 0.0 galactinol synthase 1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004717 711 / 0 AT4G16600 673 / 0.0 Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Lus10008518 670 / 0 AT2G35710 632 / 0.0 Nucleotide-diphospho-sugar transferases superfamily protein (.1.2.3)
Lus10027949 113 / 7e-27 AT5G18480 635 / 0.0 plant glycogenin-like starch initiation protein 6 (.1)
Lus10000817 86 / 5e-19 AT5G18480 329 / 2e-111 plant glycogenin-like starch initiation protein 6 (.1)
Lus10021731 68 / 7e-12 AT4G33330 803 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
Lus10028623 68 / 8e-12 AT1G77130 830 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Lus10020890 68 / 9e-12 AT3G18660 828 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Lus10033485 67 / 1e-11 AT3G18660 677 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Lus10018922 67 / 2e-11 AT1G77130 847 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Lus10042658 66 / 4e-11 AT4G33330 801 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
PFAM info
Representative CDS sequence
>Potri.001G158000.1 pacid=42791335 polypeptide=Potri.001G158000.1.p locus=Potri.001G158000 ID=Potri.001G158000.1.v4.1 annot-version=v4.1
ATGGCTTCTTCTCGAGAGCCTTGGTTAATGTTGAGGTTTTTGCTGGTTTTAGTTTTCGCTGTGTATAAAACGACAGCGTTTGGAGAGGTCATGAGGGCAC
CCCAGATAGAGCAGCAGCAGCAAGAGGGGCAACGCCAGCGGCACAAAAACGCATATGCGACGATGATGTATATGGGGACGCCAAGAGACTATGATTTCTA
CGTGGCTATACGTGTCATGCTCAGATCTCTTGCTAGATTACACGTGGATGCTGATCTCGTCGTCATTGCCTCTCACGATGTTCCTCTCCGTTGGGTTCAT
ACCATGGAACAGGAAGATGGCGCAAGGGTAATGAGAGTGGAAAATGTGGACAATCCTTATAAGAACCAACCCAATTTCAATAGGAGATTTAAGTTAACAT
TGAACAAACTCTACGTATGGAAATTGATTGAATATGAGAGGGTCGTCATGCTTGATGCTGACAATCTTTTCCTTAGAAGAGCTGATGAGCTTTTCCAATG
TGGACAGTTCTGTGCAGTCTTCATCAACCCCTGCATCTTCCATACTGGCCTCTTTGTGCTGCAGCCATCCATGGAAGTGTTTAAGGACATGCTTCATCAG
TTGGAAATTGGGAAAGAAAACCCAGATGGTGCAGACCAAGGTTTCATAAGCGGCTACTTCCCAGACTTGCTTGATATGCCGATGTTCCATCCACCTCTAA
ATGGCACCACAGTCAACGGGTCCTATAGACTTCCTTTGGGCTACCAAATGGATGCCACTTATTATTATCTTAGACTCCGCTGGAACGTACCCTGTGGGCC
TAACAGCGTGATTACTTTCCCTGGTGCATCATGGTTGAAACCATGGTATTGGTGGTCATGGCCTGTCTTGCCATTGGGCATTCAATGGCATGAACAACGT
CGCCAAAGTCTCGGATACGGGACAGAAACGCCCATGGCACTCATTCAGTGCATAGTTTACCTAGGTATAATAGCAGTAACGCGTCTAGCACGGCCAAATA
TCTCCAAGATTTGCTATCGGCGAACAGAAAAGAACATCTCCGTAATACAAGCCGGTCTTAAAATGCTAGCAATATGGTCAATTCTTGCAGCCTATTTACT
CCCCTGCATCATCATTCCTTGCACAATTCATCCATTATTAGGCTGGGGATTGTACTTGCTCGGTTCTTTTGCACTTTGCTCCATGGCTATCAATGCGTTT
ATGCTGCCGATGTTACCAGTTTTGACTCCATGCCTAGGGATATTCGGGGTCCTCTTGGTCATGGCATTTCCTCTCTACCCGAATGGTATTATAAGATGTT
TATCTATTTTCGGTTACGCATTTTGTGCTGCACCTTTTCTCTGGGTATCACTGGTTAAGATCATGGCAAGCCTTCAAGCATCACTTGAAAGGGAAAACTT
CTTCCCTAGATTGGGTGAATCTTCGCCACCTTCTGGATTCAACAAGTTATATTAG
AA sequence
>Potri.001G158000.1 pacid=42791335 polypeptide=Potri.001G158000.1.p locus=Potri.001G158000 ID=Potri.001G158000.1.v4.1 annot-version=v4.1
MASSREPWLMLRFLLVLVFAVYKTTAFGEVMRAPQIEQQQQEGQRQRHKNAYATMMYMGTPRDYDFYVAIRVMLRSLARLHVDADLVVIASHDVPLRWVH
TMEQEDGARVMRVENVDNPYKNQPNFNRRFKLTLNKLYVWKLIEYERVVMLDADNLFLRRADELFQCGQFCAVFINPCIFHTGLFVLQPSMEVFKDMLHQ
LEIGKENPDGADQGFISGYFPDLLDMPMFHPPLNGTTVNGSYRLPLGYQMDATYYYLRLRWNVPCGPNSVITFPGASWLKPWYWWSWPVLPLGIQWHEQR
RQSLGYGTETPMALIQCIVYLGIIAVTRLARPNISKICYRRTEKNISVIQAGLKMLAIWSILAAYLLPCIIIPCTIHPLLGWGLYLLGSFALCSMAINAF
MLPMLPVLTPCLGIFGVLLVMAFPLYPNGIIRCLSIFGYAFCAAPFLWVSLVKIMASLQASLERENFFPRLGESSPPSGFNKLY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G16600 Nucleotide-diphospho-sugar tra... Potri.001G158000 0 1
AT3G57710 Protein kinase superfamily pro... Potri.002G004900 6.00 0.7252
AT1G49850 RING/U-box superfamily protein... Potri.001G297000 6.92 0.6495
AT2G40950 bZIP BZIP17 Basic-leucine zipper (bZIP) tr... Potri.016G032400 17.34 0.6693
AT5G45190 Cyclin family protein (.1.2) Potri.002G032300 24.79 0.6835
AT1G73150 GTE3 global transcription factor gr... Potri.001G285700 25.03 0.6041 GTE906
AT4G28530 NAC ANAC074 NAC domain containing protein ... Potri.002G037100 27.92 0.6733
AT4G33420 Peroxidase superfamily protein... Potri.018G136900 31.68 0.6814
AT4G30630 unknown protein Potri.006G183000 32.52 0.6327
AT5G58430 ATEXO70B1 exocyst subunit exo70 family p... Potri.019G124000 32.66 0.5809
Potri.003G105450 43.95 0.6469

Potri.001G158000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.