Potri.001G158800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39720 58 / 6e-10 VQ motif-containing protein (.1)
AT5G65170 54 / 2e-08 VQ motif-containing protein (.1)
AT1G35830 53 / 2e-08 VQ motif-containing protein (.1)
AT4G20000 47 / 2e-06 VQ motif-containing protein (.1)
AT2G41010 45 / 8e-06 ATCAMBP25 calmodulin (CAM)-binding protein of 25 kDa (.1)
AT3G22160 45 / 1e-05 VQ motif-containing protein (.1)
AT3G56880 44 / 2e-05 VQ motif-containing protein (.1)
AT4G15120 44 / 3e-05 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G075800 290 / 3e-100 AT3G22160 54 / 8e-09 VQ motif-containing protein (.1)
Potri.006G006300 66 / 6e-13 AT4G39720 49 / 2e-06 VQ motif-containing protein (.1)
Potri.005G076600 56 / 5e-09 AT5G65170 70 / 7e-13 VQ motif-containing protein (.1)
Potri.005G166100 55 / 7e-09 AT5G65170 94 / 8e-21 VQ motif-containing protein (.1)
Potri.002G094900 54 / 3e-08 AT1G35830 89 / 1e-19 VQ motif-containing protein (.1)
Potri.016G017900 49 / 5e-07 AT4G15120 / VQ motif-containing protein (.1)
Potri.007G091600 45 / 2e-05 AT5G65170 72 / 2e-13 VQ motif-containing protein (.1)
Potri.016G029600 44 / 4e-05 AT3G56880 125 / 4e-35 VQ motif-containing protein (.1)
Potri.006G032300 43 / 6e-05 AT3G56880 127 / 1e-35 VQ motif-containing protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016814 55 / 2e-09 AT4G39720 52 / 4e-08 VQ motif-containing protein (.1)
Lus10024738 54 / 2e-08 AT1G35830 92 / 3e-21 VQ motif-containing protein (.1)
Lus10006941 54 / 2e-08 AT1G35830 93 / 3e-21 VQ motif-containing protein (.1)
Lus10012292 40 / 0.0006 AT3G56880 125 / 1e-35 VQ motif-containing protein (.1)
Lus10015982 40 / 0.0007 AT3G56880 135 / 5e-39 VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.001G158800.1 pacid=42791199 polypeptide=Potri.001G158800.1.p locus=Potri.001G158800 ID=Potri.001G158800.1.v4.1 annot-version=v4.1
ATGGCTAGTTCGTCGAGTGATTGGGTGCAACTCTATGAACAAGCCAATATTCATGGACAGGCAACACCTTCCTTTGGATTCTCAGATGCCACCAATGTTG
CAACCAGTGGTGCATCGCATATCATAAATCCAAGCAGTTCAATTACATCAAGTGCTGGTGATCAGACGTTGACCCCTAAAGGTTGTGGGTCGAAGCCAAT
CAAAAGGAGATCTAGAGCTTCTAAGAAGACACCAAGCACCCTGCTCACTGCCACCACCGCAAATTTCAGAGCCTTGGTGCAACAATTCACTGGCTGTCCT
AGTATTCCCATTTCAATCGGGAACCAAAAGGGTCCAATCACCTTGAATTTTGGACTCGGGAGTGCACAAGATCATAGCTACGCGACTGCAGAAATGGCAC
CTTTTGACAACATTTATTATCATGGGCAATCTCAGATGCAAGGACGACAGCAACCGAGGGAAAACGCACAGCAACTGCACCAGGACCAAGGATTACTTGA
TCATCTTCCTAATAGTAATGCTTACTTCTCGTTGTCTAGTGACCTTGGACCTAATTTAGACAGGCCAGCTGATGATGGGCTTTTCAATATGGACGATATT
GCTTTGCAAGAGCTTGCTAAGGAGTCTTTCTCCGATGAAAATATGAATAATATTGATTGCTTTTAG
AA sequence
>Potri.001G158800.1 pacid=42791199 polypeptide=Potri.001G158800.1.p locus=Potri.001G158800 ID=Potri.001G158800.1.v4.1 annot-version=v4.1
MASSSSDWVQLYEQANIHGQATPSFGFSDATNVATSGASHIINPSSSITSSAGDQTLTPKGCGSKPIKRRSRASKKTPSTLLTATTANFRALVQQFTGCP
SIPISIGNQKGPITLNFGLGSAQDHSYATAEMAPFDNIYYHGQSQMQGRQQPRENAQQLHQDQGLLDHLPNSNAYFSLSSDLGPNLDRPADDGLFNMDDI
ALQELAKESFSDENMNNIDCF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G39720 VQ motif-containing protein (.... Potri.001G158800 0 1
AT3G48520 CYP94B3 cytochrome P450, family 94, su... Potri.005G220700 2.23 0.9058 Pt-CYP94.7
AT1G67850 Protein of unknown function (D... Potri.008G185600 3.87 0.8691
AT1G78340 ATGSTU22 glutathione S-transferase TAU ... Potri.019G130566 3.87 0.8759
AT1G17180 ATGSTU25 glutathione S-transferase TAU ... Potri.019G130433 4.00 0.8693
AT5G20230 SAG14, ATBCB SENESCENCE ASSOCIATED GENE 14,... Potri.006G067300 4.47 0.8832
AT5G25930 Protein kinase family protein ... Potri.006G235450 6.92 0.8599
AT5G16170 Core-2/I-branching beta-1,6-N-... Potri.015G045500 7.41 0.8512
AT4G06536 SPla/RYanodine receptor (SPRY)... Potri.014G025000 10.58 0.8623
AT5G04760 MYB Duplicated homeodomain-like su... Potri.010G240800 11.40 0.8487
AT3G06490 MYB BOS1, AtMYB108 BOTRYTIS-SUSCEPTIBLE1, myb dom... Potri.008G101400 12.64 0.8414 MYB108.2

Potri.001G158800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.