Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35010 162 / 7e-51 ATO1 thioredoxin O1 (.1.2) AT1G31020 147 / 2e-45 ATO2 thioredoxin O2 (.1) AT3G51030 76 / 6e-18 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT3G17880 77 / 6e-17 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) AT1G45145 73 / 7e-17 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT5G42980 72 / 2e-16 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G69880 71 / 8e-16 ATH8 thioredoxin H-type 8 (.1) AT3G08710 70 / 2e-15 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) AT5G39950 63 / 8e-13 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT1G59730 62 / 1e-12 ATH7 thioredoxin H-type 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G045000 [exp] 95 / 2e-23 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.015G036000 [exp] 85 / 1e-19 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.005G232700 [exp] 72 / 1e-16 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.002G030000 [exp] 72 / 3e-16 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.006G110100 [exp] 72 / 4e-16 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.007G018000 [exp] 69 / 4e-15 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.005G186800 [exp] 69 / 1e-14 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2) Potri.016G138800 [exp] 66 / 9e-14 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.002G073000 [exp] 66 / 2e-13 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016544 [exp] 124 / 6e-36 AT2G35010 113 / 1e-31 thioredoxin O1 (.1.2) Lus10024293 [exp] 82 / 2e-20 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10028349 [exp] 81 / 6e-20 AT3G51030 179 / 1e-59 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10041799 [exp] 81 / 9e-20 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10000802 [exp] 81 / 1e-19 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10031334 [exp] 84 / 7e-19 AT3G17880 456 / 3e-160 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Lus10014277 [exp] 77 / 3e-18 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10014186 [exp] 73 / 1e-16 AT3G08710 192 / 3e-64 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10022727 [exp] 72 / 2e-16 AT3G08710 189 / 6e-63 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10007630 [exp] 70 / 3e-15 AT1G11530 143 / 4e-45 C-terminal cysteine residue is changed to a serine 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00085 [poplar] [flax] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Potri.001G159000.1 pacid=42789920 polypeptide=Potri.001G159000.1.p locus=Potri.001G159000 ID=Potri.001G159000.1.v4.1 annot-version=v4.1 ATGAGGGGGAATAATAAGGCACTGCTGGTTCGAGCTTTAATTTTCGGAAGCCACCGGAGTTCAATGAACTCCTTCTCCCGTCATCTTCATGAAAACCTAA TTTCAAATCCAAGCAAAACCTCACATCCTTCTAAATCTCTCTCCAACTTCACCACAAAATTTCACTTCTCAACTCCTTATCTGCAACCCTTCCAAAGAAC CCTCTGCTCCTCCTCCTCCTCCGGTGCATCAAACATTGTTCTTGTAAAATCAGATGAAGAGCTGAATAGCGGACTGAAAAATGTTCAAGAGAAGTCTTCT CCAGCGGTTTTCTATTTTACTGCTACATGGTGTGGGCCTTGCAAGTTTATATCTCCTGTAATCGAAGAGCTGAGTAAGAAATACCCTCATGCAACAATAT ATAAAGTTGACATTGACACGGAAGGTCTTCAAAATGCGTTGGCGAGCTTGAATATTGCTGCTGTGCCAACTCTTGATTTCTACAAAAATGGCAAAAAGGA AACTACAATTGTTGGTGCTGATGTTGCCAAGTTGAAGAATACCATGGAATCTCTCTACAGGGAGGATTAA
AA sequence Show only first row Show all	>Potri.001G159000.1 pacid=42789920 polypeptide=Potri.001G159000.1.p locus=Potri.001G159000 ID=Potri.001G159000.1.v4.1 annot-version=v4.1 MRGNNKALLVRALIFGSHRSSMNSFSRHLHENLISNPSKTSHPSKSLSNFTTKFHFSTPYLQPFQRTLCSSSSSGASNIVLVKSDEELNSGLKNVQEKSS PAVFYFTATWCGPCKFISPVIEELSKKYPHATIYKVDIDTEGLQNALASLNIAAVPTLDFYKNGKKETTIVGADVAKLKNTMESLYRED

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G35010		ATO1	thioredoxin O1 (.1.2)		Potri.001G159000 [exp]	0	1
AT1G64350		SEH1H	Transducin/WD40 repeat-like su...		Potri.003G138300 [exp]	4.00	0.8449	SEH1.1
AT5G51880			2-oxoglutarate (2OG) and Fe(II...		Potri.015G135300 [exp]	7.21	0.8511
AT1G76050			Pseudouridine synthase family ...		Potri.002G016800 [exp]	14.31	0.8587
AT5G59910		HTB4	Histone superfamily protein (....		Potri.008G030400 [exp]	14.69	0.8328
AT1G53280		AtDJ1B	DJ-1 homolog B, Class I glutam...		Potri.011G111900 [exp]	16.88	0.8426
					Potri.019G045600 [exp]	20.14	0.8732
AT1G31340		NEDD8, ATRUB1, ...	ARABIDOPSIS THALIANA RELATED T...		Potri.007G067500 [exp]	20.49	0.8374	Pt-UBQ7.1
AT5G12190			RNA-binding (RRM/RBD/RNP motif...		Potri.009G067500 [exp]	23.81	0.8554
AT4G32605			Mitochondrial glycoprotein fam...		Potri.008G015600 [exp]	24.91	0.8621
AT1G31340		NEDD8, ATRUB1, ...	ARABIDOPSIS THALIANA RELATED T...		Potri.002G062500 [exp]	33.04	0.7898

Compare expression of checked genes

Potri.001G159000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.