Plant FIBer expression Database

Potri.001G164800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G54070 67 / 3e-15 Dormancy/auxin associated family protein (.1)
AT1G56220 50 / 1e-08 Dormancy/auxin associated family protein (.1.2.3.4)
AT1G28330 45 / 6e-07 DYL1, DRM1 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G070500
[exp]
109 / 6e-32 AT1G54070 90 / 6e-24 Dormancy/auxin associated family protein (.1)
Potri.005G024250
[exp]
49 / 1e-08 AT1G56220 86 / 2e-23 Dormancy/auxin associated family protein (.1.2.3.4)
Potri.013G014900
[exp]
45 / 9e-07 AT1G56220 97 / 7e-27 Dormancy/auxin associated family protein (.1.2.3.4)
Potri.004G047100
[exp]
42 / 1e-05 AT1G28330 122 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013180
[exp]
73 / 5e-17 AT1G54070 78 / 5e-19 Dormancy/auxin associated family protein (.1)
Lus10008142
[exp]
67 / 4e-15 AT1G54070 65 / 1e-14 Dormancy/auxin associated family protein (.1)
Lus10020661
[exp]
54 / 5e-10 AT1G56220 126 / 2e-38 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10029881
[exp]
53 / 5e-09 AT5G27830 245 / 9e-80 unknown protein
Lus10031488
[exp]
49 / 3e-08 AT1G56220 136 / 3e-42 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10015193
[exp]
49 / 6e-08 AT1G56220 134 / 3e-41 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10013997
[exp]
42 / 1e-05 AT1G28330 119 / 4e-36 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Lus10013996
[exp]
41 / 1e-05 AT1G28330 74 / 2e-18 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Lus10015418
[exp]
41 / 2e-05 AT1G28330 120 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05564 Auxin_repressed Dormancy/auxin associated protein
Representative CDS sequence
>Potri.001G164800.6 pacid=42790119 polypeptide=Potri.001G164800.6.p locus=Potri.001G164800 ID=Potri.001G164800.6.v4.1 annot-version=v4.1
ATGGGATTTCTCCATAAGCTTTGGGACGAAACGCTTGCTGGACCCATGCCGGACACTGGGCTTGGCAAACTTCGAAAGTATAATTCATTCCCTGTACGAT
TATCACCTCCTGTTAATGCTTCTTCAGCTAATAGCAATGGGGAGATGAACGTAACTCGAAGCATTACTATTATTAGAACAAACAGTTCCAATTTGAGGAA
CCTTTCAGTGGATCCTGGTTCAGCTCCTGAGTCGCCTGCTCCACCTAGCACTCCTGGGACACCTCTAACACTGCGTTGTAAGCTTGGCCGGTGTGTATTT
ATGCTAATTTGGGCCTTTGGTCATGTATGCATGCAGCTGGGACACCGCGCGGGGATTTCAGAAGAATGA
AA sequence
>Potri.001G164800.6 pacid=42790119 polypeptide=Potri.001G164800.6.p locus=Potri.001G164800 ID=Potri.001G164800.6.v4.1 annot-version=v4.1
MGFLHKLWDETLAGPMPDTGLGKLRKYNSFPVRLSPPVNASSANSNGEMNVTRSITIIRTNSSNLRNLSVDPGSAPESPAPPSTPGTPLTLRCKLGRCVF
MLIWAFGHVCMQLGHRAGISEE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G54070 Dormancy/auxin associated fami... Potri.001G164800
[exp]
0 1
AT5G56550 ATOXS3 oxidative stress 3 (.1) Potri.001G190700
[exp]
2.44 0.9343
Potri.002G056400
[exp]
2.82 0.9234
AT5G21090 Leucine-rich repeat (LRR) fami... Potri.003G166200
[exp]
5.56 0.9510
AT3G14470 NB-ARC domain-containing disea... Potri.006G272066
[exp]
5.83 0.9360
AT1G65810 P-loop containing nucleoside t... Potri.008G142960
[exp]
7.41 0.9256
AT5G52120 ATPP2-A14 phloem protein 2-A14 (.1) Potri.012G136200
[exp]
8.71 0.9081
AT1G80920 AtToc12, AtJ8, ... translocon at the outer envelo... Potri.001G043100
[exp]
10.19 0.9272 J8.1
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Potri.010G063000
[exp]
16.43 0.9158
AT4G19160 unknown protein Potri.001G193400
[exp]
16.88 0.9038
AT1G75820 ATCLV1, FLO5, F... FLOWER DEVELOPMENT 5, FASCIATA... Potri.005G241500
[exp]
20.44 0.9156 CLV1.2

Potri.001G164800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.