Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-SEC22.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11890 428 / 7e-155 ATSEC22, SEC22 SECRETION 22, Synaptobrevin family protein (.1) AT5G52270 116 / 4e-32 SNARE-like superfamily protein (.1) AT5G58060 54 / 7e-09 ATYKT61, ATGP1, YKT61 SNARE-like superfamily protein (.1.2) AT2G25340 53 / 2e-08 ATVAMP712 vesicle-associated membrane protein 712 (.1) AT5G22360 52 / 3e-08 ATVAMP714 vesicle-associated membrane protein 714 (.1) AT4G32150 51 / 8e-08 ATVAMP711, VAMP7C vesicle-associated membrane protein 711 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G069900 [exp] 448 / 7e-163 AT1G11890 429 / 2e-155 SECRETION 22, Synaptobrevin family protein (.1) Potri.012G140600 [exp] 149 / 7e-45 AT5G52270 211 / 2e-69 SNARE-like superfamily protein (.1) Potri.009G018900 [exp] 59 / 1e-10 AT5G22360 367 / 6e-131 vesicle-associated membrane protein 714 (.1) Potri.001G219200 [exp] 58 / 3e-10 AT5G22360 369 / 1e-131 vesicle-associated membrane protein 714 (.1) Potri.006G256200 [exp] 55 / 3e-09 AT4G32150 352 / 5e-125 vesicle-associated membrane protein 711 (.1) Potri.018G110700 [exp] 55 / 3e-09 AT5G58060 375 / 8e-135 SNARE-like superfamily protein (.1.2) Potri.006G187700 [exp] 54 / 5e-09 AT5G58060 381 / 5e-137 SNARE-like superfamily protein (.1.2) Potri.018G025800 [exp] 54 / 7e-09 AT4G32150 366 / 2e-130 vesicle-associated membrane protein 711 (.1) Potri.018G125900 [exp] 52 / 5e-08 AT4G32150 276 / 1e-94 vesicle-associated membrane protein 711 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036987 [exp] 424 / 2e-153 AT1G11890 415 / 6e-150 SECRETION 22, Synaptobrevin family protein (.1) Lus10013175 [exp] 420 / 1e-151 AT1G11890 411 / 2e-148 SECRETION 22, Synaptobrevin family protein (.1) Lus10008135 [exp] 371 / 7e-132 AT1G11890 363 / 7e-129 SECRETION 22, Synaptobrevin family protein (.1) Lus10015808 [exp] 117 / 6e-31 AT5G08530 440 / 6e-153 51 kDa subunit of complex I (.1) Lus10043394 [exp] 54 / 1e-08 AT5G22360 400 / 6e-144 vesicle-associated membrane protein 714 (.1) Lus10034189 [exp] 54 / 1e-08 AT5G22360 400 / 6e-144 vesicle-associated membrane protein 714 (.1) Lus10006192 [exp] 50 / 2e-07 AT5G11150 345 / 9e-121 vesicle-associated membrane protein 713 (.1) Lus10000754 [exp] 50 / 3e-07 AT1G04760 372 / 8e-133 vesicle-associated membrane protein 726 (.1) Lus10036297 [exp] 49 / 4e-07 AT5G58060 364 / 3e-130 SNARE-like superfamily protein (.1.2) Lus10019047 [exp] 48 / 9e-07 AT5G58060 362 / 3e-129 SNARE-like superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0445 [poplar] [flax] SNARE-fusion PF00957 [poplar] [flax] Synaptobrevin Synaptobrevin CL0431 [poplar] [flax] PF PF13774 [poplar] [flax] Longin Regulated-SNARE-like domain
Representative CDS sequence Show only first row Show all	>Potri.001G165600.1 pacid=42790782 polypeptide=Potri.001G165600.1.p locus=Potri.001G165600 ID=Potri.001G165600.1.v4.1 annot-version=v4.1 ATGGTGAAGCTGACAATGATCGCGCGTGTTACTGATGGACTTCCGCTAGCAGAGGGACTGGATGATGGTCGTGATGTGAAAGATGCTGAAATGTACAAGC AGCAGGTCAAGGCACTTTTCAAGAACCTTGCATCTGGCCACAATGACGCATCGAGGATGTCCGTTGAAACTGGTCCTTATGTTTTCCATTATATCATTGA AGGACGTGTTTGTTACCTTACTATGTGTGACCGCTCTTATCCTAAGAAACTTGCCTTTCAATACCTGGAAGACCTTAAGAATGAATTTGAACGTGTCAAT GGGGCTCAAATTGAAACTGCTGCTAGACCATATGCCTTCATTAAATTTGATACTTTCATACAGAAAACAAAGAAGTTGTATCAGGACACCCGCACCCAGC GGAACGTTGCAAAGTTGAATGATGAGCTGTATGAAGTCCACCAAATAATGACTCGCAATGTGCAGGAAGTTTTGGGTGTTGGTGAAAAGCTGGACCAGGT CAGTCAAATGTCAAGTCGGTTAACATCAGAATCTCGCATATATGCTGAAAAGGCAAGAGATTTGAATCGACAGGCCTTAATTCGAAAATGGGCCCCTGTT GCTATTGTGCTAGGAGTTGTCTTCCTCCTCTTTTGGGTTAAAACAAAGCTCTGGTGA
AA sequence Show only first row Show all	>Potri.001G165600.1 pacid=42790782 polypeptide=Potri.001G165600.1.p locus=Potri.001G165600 ID=Potri.001G165600.1.v4.1 annot-version=v4.1 MVKLTMIARVTDGLPLAEGLDDGRDVKDAEMYKQQVKALFKNLASGHNDASRMSVETGPYVFHYIIEGRVCYLTMCDRSYPKKLAFQYLEDLKNEFERVN GAQIETAARPYAFIKFDTFIQKTKKLYQDTRTQRNVAKLNDELYEVHQIMTRNVQEVLGVGEKLDQVSQMSSRLTSESRIYAEKARDLNRQALIRKWAPV AIVLGVVFLLFWVKTKLW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G11890		ATSEC22, SEC22	SECRETION 22, Synaptobrevin fa...		Potri.001G165600 [exp]	0	1	Pt-SEC22.1
AT5G08160		ATPK3	serine/threonine protein kinas...		Potri.015G055200 [exp]	1.73	0.9305
AT3G58130			N-acetylglucosaminylphosphatid...		Potri.012G041700 [exp]	2.00	0.9307
AT5G25760		PEX4, UBC21	ubiquitin-conjugating enzyme 2...		Potri.018G039200 [exp]	2.23	0.9154
AT2G18030			Peptide methionine sulfoxide r...		Potri.007G012900 [exp]	2.44	0.9154	PtrcMsrA5
AT3G09740		ATSYP71, SYP71	syntaxin of plants 71 (.1)		Potri.016G088200 [exp]	2.82	0.9383	SYP71.2
AT2G17990			unknown protein		Potri.005G115500 [exp]	4.00	0.9210
AT3G12587			Oligosaccaryltransferase (.1)		Potri.008G053200 [exp]	4.89	0.9004
AT4G25600			Oxoglutarate/iron-dependent ox...		Potri.012G142800 [exp]	5.29	0.9152
AT5G49540			Rab5-interacting family protei...		Potri.010G148600 [exp]	7.74	0.9048
AT4G33410		ATSPPL1	SIGNAL PEPTIDE PEPTIDASE-LIKE ...		Potri.012G142400 [exp]	8.71	0.8877

Compare expression of checked genes

Potri.001G165600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.