Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20570 203 / 3e-69 HRT1, ROC1, RBX1, ATRBX1 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) AT3G42830 179 / 4e-60 RING/U-box superfamily protein (.1) AT3G05870 69 / 1e-16 APC11 anaphase-promoting complex/cyclosome 11 (.1.2) AT3G47180 41 / 3e-05 RING/U-box superfamily protein (.1) AT5G40250 40 / 0.0002 RING/U-box superfamily protein (.1) AT1G65040 39 / 0.0002 AtHrd1B homolog of yeast Hrd1, RING/U-box superfamily protein (.1.2.3) AT5G17600 39 / 0.0002 RING/U-box superfamily protein (.1) AT3G16090 39 / 0.0002 AtHrd1A homolog of yeast Hrd1, RING/U-box superfamily protein (.1) AT4G12140 39 / 0.0002 RING/U-box superfamily protein (.1) AT3G48030 39 / 0.0003 hypoxia-responsive family protein / zinc finger (C3HC4-type RING finger) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G067100 [exp] 228 / 3e-79 AT5G20570 206 / 2e-70 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) Potri.006G141300 [exp] 211 / 1e-72 AT5G20570 209 / 1e-71 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) Potri.017G037701 [exp] 48 / 1e-08 AT3G05870 123 / 5e-39 anaphase-promoting complex/cyclosome 11 (.1.2) Potri.001G322600 [exp] 43 / 7e-06 AT5G08139 71 / 5e-14 RING/U-box superfamily protein (.1) Potri.002G140600 [exp] 42 / 2e-05 AT3G60220 194 / 3e-59 TOXICOS EN LEVADURA 4 (.1) Potri.006G239500 [exp] 39 / 0.0003 AT2G20030 248 / 1e-78 RING/U-box superfamily protein (.1) Potri.013G088400 [exp] 38 / 0.0005 AT3G16090 613 / 0.0 homolog of yeast Hrd1, RING/U-box superfamily protein (.1) Potri.002G101800 [exp] 38 / 0.0005 AT1G72220 195 / 3e-58 RING/U-box superfamily protein (.1) Potri.009G110000 [exp] 38 / 0.0006 AT3G18930 227 / 5e-70 RING/U-box superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013153 [exp] 207 / 6e-71 AT5G20570 206 / 2e-70 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) Lus10015667 [exp] 206 / 2e-70 AT5G20570 200 / 5e-68 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) Lus10008115 [exp] 133 / 8e-42 AT5G20570 129 / 2e-40 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) Lus10037680 [exp] 127 / 8e-40 AT5G20570 122 / 9e-38 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) Lus10015126 [exp] 68 / 2e-15 AT3G05870 156 / 2e-50 anaphase-promoting complex/cyclosome 11 (.1.2) Lus10031549 [exp] 67 / 1e-14 AT3G05870 158 / 6e-50 anaphase-promoting complex/cyclosome 11 (.1.2) Lus10022743 [exp] 43 / 8e-06 AT3G10910 154 / 5e-48 RING/U-box superfamily protein (.1) Lus10040359 [exp] 39 / 0.0004 AT3G16090 652 / 0.0 homolog of yeast Hrd1, RING/U-box superfamily protein (.1) Lus10023477 [exp] 39 / 0.0004 AT3G16090 650 / 0.0 homolog of yeast Hrd1, RING/U-box superfamily protein (.1) Lus10034587 [exp] 38 / 0.0005 AT1G68070 489 / 6e-172 Zinc finger, C3HC4 type (RING finger) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF12861 [poplar] [flax] zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger
Representative CDS sequence Show only first row Show all	>Potri.001G167400.1 pacid=42793713 polypeptide=Potri.001G167400.1.p locus=Potri.001G167400 ID=Potri.001G167400.1.v4.1 annot-version=v4.1 ATGGACACGGACGTGACGATGGTTACGGCAGGCGAGGCAAGTTCGTCTTCCTCAAGGAAACCGAAGCGATTCGAAATCAAGAAGTGGAATGCTGTCGCTC TTTGGGCTTGGGATATTGTTGTGGATAACTGCGCTATTTGTAGGAATCATATCATGGATCTTTGCATTGAGTGTCAAGCAAATCAAGCGAGTGCTACAAG CGAGGAGTGCACTGTTGCCTGGGGTGTGTGCAATCATGCCTTCCACTTCCACTGTATCAGCCGATGGCTCAAAACCCGCCAAGTGTGCCCTCTTGATAAT AGCGAGTGGGAGTTCCAGAAGTATGGCCACTAA
AA sequence Show only first row Show all	>Potri.001G167400.1 pacid=42793713 polypeptide=Potri.001G167400.1.p locus=Potri.001G167400 ID=Potri.001G167400.1.v4.1 annot-version=v4.1 MDTDVTMVTAGEASSSSSRKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDN SEWEFQKYGH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G20570		HRT1, ROC1, RBX...	REGULATOR OF CULLINS-1, RING-b...		Potri.001G167400 [exp]	0	1
AT2G19460			Protein of unknown function (D...		Potri.001G197700 [exp]	1.73	0.7393
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Potri.014G158300 [exp]	7.34	0.6691	SMT3.2
AT1G25380		ATNDT2	NAD+ transporter 2, ARABIDOPSI...		Potri.008G123700 [exp]	11.40	0.6580
AT5G55560			Protein kinase superfamily pro...		Potri.014G164100 [exp]	16.61	0.6742
AT2G29700		ATPH1	pleckstrin homologue 1 (.1)		Potri.001G250400 [exp]	19.44	0.6395	Pt-ATPH1.2
AT1G61700			RNA polymerases N / 8 kDa subu...		Potri.003G102900 [exp]	21.56	0.6270
AT1G03150			Acyl-CoA N-acyltransferases (N...		Potri.005G210400 [exp]	28.98	0.6466	SGB903
AT3G52420		ATOEP7	outer envelope membrane protei...		Potri.005G208100 [exp]	30.51	0.6415	OM14.1
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Potri.001G334600 [exp]	37.10	0.6142
AT3G53310	B3	REM20	AP2/B3-like transcriptional fa...		Potri.011G005300 [exp]	37.84	0.6594

Compare expression of checked genes

Potri.001G167400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.