Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14000 467 / 2e-165 ATBRXL2, BRX-LIKE2 DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1), DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.2) AT1G54180 460 / 4e-163 ATBRXL3, BRX-LIKE3 ARABIDOPSIS THALIANA BREVIS RADIX-LIKE 3, BREVIS RADIX-like 3 (.1.2) AT5G20540 395 / 1e-136 ATBRXL4, BRX-LIKE4 BREVIS RADIX-like 4 (.1) AT1G31880 250 / 2e-80 BRX, NIP3;1, NLM9 BREVIS RADIX, DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1) AT2G35600 232 / 7e-74 BRXL1, ATBRXL1, BRX-LIKE1 ARABIDOPSIS THALIANA BREVIS RADIX LIKE 1, BREVIS RADIX-like 1 (.1) AT2G21030 123 / 5e-34 unknown protein AT5G12350 87 / 3e-18 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT5G19420 83 / 6e-17 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) AT1G69710 72 / 2e-13 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT1G65920 62 / 3e-10 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G063200 [exp] 623 / 0 AT3G14000 492 / 4e-175 DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1), DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.2) Potri.006G144900 [exp] 464 / 4e-164 AT5G20540 422 / 2e-147 BREVIS RADIX-like 4 (.1) Potri.018G064900 [exp] 447 / 3e-157 AT5G20540 426 / 1e-148 BREVIS RADIX-like 4 (.1) Potri.001G131800 [exp] 304 / 2e-101 AT1G31880 462 / 4e-164 BREVIS RADIX, DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1) Potri.003G101500 [exp] 301 / 3e-100 AT1G31880 434 / 8e-153 BREVIS RADIX, DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1) Potri.009G071800 [exp] 88 / 1e-18 AT5G19420 1610 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.002G070300 [exp] 83 / 5e-17 AT5G42140 1422 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Potri.005G190000 [exp] 80 / 5e-16 AT5G42140 1407 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Potri.001G026900 [exp] 77 / 7e-15 AT5G19420 1281 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008459 [exp] 463 / 8e-164 AT3G14000 441 / 1e-155 DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1), DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.2) Lus10000884 [exp] 454 / 2e-160 AT3G14000 439 / 3e-154 DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1), DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.2) Lus10017164 [exp] 334 / 3e-113 AT5G20540 457 / 1e-161 BREVIS RADIX-like 4 (.1) Lus10021565 [exp] 321 / 8e-108 AT5G20540 420 / 1e-146 BREVIS RADIX-like 4 (.1) Lus10030349 [exp] 231 / 2e-73 AT1G31880 410 / 5e-144 BREVIS RADIX, DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1) Lus10007898 [exp] 196 / 2e-60 AT1G31880 363 / 1e-126 BREVIS RADIX, DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein (.1) Lus10009701 [exp] 84 / 4e-17 AT5G19420 1567 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Lus10036030 [exp] 84 / 4e-17 AT5G19420 1644 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Lus10029772 [exp] 81 / 3e-16 AT5G42140 1463 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Lus10018904 [exp] 80 / 6e-16 AT1G76950 1520 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08381 [poplar] [flax] BRX Transcription factor regulating root and shoot growth via Pin3
Representative CDS sequence Show only first row Show all	>Potri.001G170800.1 pacid=42793593 polypeptide=Potri.001G170800.1.p locus=Potri.001G170800 ID=Potri.001G170800.1.v4.1 annot-version=v4.1 ATGTTGACTTGTATTGCGTGTTCAAAGCAACTTAACAATGGATCTTTGCAACAAAGGGAGAGAGAAGAGGATGTTGATGTTGCTGCTTTGGAGACACCCA GGACTAAGCAGGCCATCAAGGCTCTCACTGCTCAAATAAAGGATATGGCAGTCAAGGCATCAGGAGCATATAGAAACTGCAAGCCATGTTCAGGATCCTC GAACAATAACAGTAACCGGAACTATGCCGAGTCTGATGCTGCCTCAGACTCAGCCAGGTTCCACTGCTCGTATCGTAGAACAGGAAGTTCCAATTCGACC CCGAGAATGTGGGGGAAAGAGATGGAGGCAAGACTAAAAGGGCTATCAGGTGGTGAAGGCACACCTGCTTCAGTAAGTGGCCGGACAGAGTCTGTGGCTT TTATGGAGGAAGATGAGCCTAAGGAGTGGGTTGCACAAGTTGAGCCAGGCGTGCTCATCGCTTTTCATTCATTGCCTGATGGTGGTAATGATCTGAAGCG GATTCGATTCAGTCGTGAAATGTTCAACAAATGGCAAGCTCAAAGGTGGTGGGCTGAGAACTATGACAAGGTCATGGAATTATACAATGTTCGACAGTTC AATCATCAAGCAGTCCCACTTCCAACTCCGCCAAGATCTGAAGATGAGAGCTCAAAGCCTGAATCTGCCAAAGACAGCCCTGTGATTCCTCCATTGGGCA AAGGATGCCCGCACAATTTCCACCTTCCAACAGGAATGGATTATTCTTCATCAGATTCACTTGACCACCACCCAATGCAATCCCACCAATATTATGATCC AGCTGGTCTTGCTTCAACACCAAAGCTCTCTGGCATTGCTGGGGCTAAAACTGAGACATCATCAATAGATGGTTCTGTGAGGACTAGTATGTCAAGAGAG TCTGATCGCTCAGAAGAACTTTCCATCAGTAATGCAAGCGATATGGAGACTGAATGGGTTGAACAGGATGAACCAGGGGTATACATCACTATCAGAGCTC TGCCTGGAGGCTCTAGGGAGCTTAGACGTGTCAGGTTCAGCCGAGAAAGATTTGAAGAAACGCAAGCAAGGTTGTGGTGGGAAGAGAACCGAGCCAGGAT ACAAGAACAGTACTTGTAG
AA sequence Show only first row Show all	>Potri.001G170800.1 pacid=42793593 polypeptide=Potri.001G170800.1.p locus=Potri.001G170800 ID=Potri.001G170800.1.v4.1 annot-version=v4.1 MLTCIACSKQLNNGSLQQREREEDVDVAALETPRTKQAIKALTAQIKDMAVKASGAYRNCKPCSGSSNNNSNRNYAESDAASDSARFHCSYRRTGSSNST PRMWGKEMEARLKGLSGGEGTPASVSGRTESVAFMEEDEPKEWVAQVEPGVLIAFHSLPDGGNDLKRIRFSREMFNKWQAQRWWAENYDKVMELYNVRQF NHQAVPLPTPPRSEDESSKPESAKDSPVIPPLGKGCPHNFHLPTGMDYSSSDSLDHHPMQSHQYYDPAGLASTPKLSGIAGAKTETSSIDGSVRTSMSRE SDRSEELSISNASDMETEWVEQDEPGVYITIRALPGGSRELRRVRFSRERFEETQARLWWEENRARIQEQYL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G14000		ATBRXL2, BRX-LI...	DZC (Disease resistance/zinc f...		Potri.001G170800 [exp]	0	1
AT3G53480		PIS1, ABCG37, P...	polar auxin transport inhibito...		Potri.008G099000 [exp]	1.73	0.8973
AT2G36650			unknown protein		Potri.005G098400 [exp]	3.46	0.8082
AT1G67590			Remorin family protein (.1.2)		Potri.008G178300 [exp]	4.24	0.7974
AT1G28590			GDSL-like Lipase/Acylhydrolase...		Potri.004G054300 [exp]	4.47	0.8673
AT5G24450			Transcription factor IIIC, sub...		Potri.017G007200 [exp]	4.58	0.8619
AT1G67980		CCOAMT	caffeoyl-CoA 3-O-methyltransfe...		Potri.008G136600 [exp]	7.07	0.8413
AT3G55570			unknown protein		Potri.001G313700 [exp]	7.21	0.8071
AT2G40470	AS2	ASL11, LBD15	ASYMMETRIC LEAVES2-LIKE 11, LO...		Potri.013G081200 [exp]	9.38	0.8454
AT1G05630		AT5PTASE13, 5PT...	Endonuclease/exonuclease/phosp...		Potri.017G006900 [exp]	9.48	0.7768
AT1G20670			DNA-binding bromodomain-contai...		Potri.019G132601 [exp]	10.39	0.8382

Compare expression of checked genes

Potri.001G170800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.