Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G80160 270 / 4e-94 GLYI7 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) AT1G15380 263 / 2e-91 GLYI4 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) AT2G28420 171 / 9e-55 GLYI8 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1) AT5G57040 54 / 2e-09 Lactoylglutathione lyase / glyoxalase I family protein (.1) AT2G32090 51 / 1e-08 Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G062400 [exp] 287 / 1e-100 AT1G80160 261 / 2e-90 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.007G129200 [exp] 228 / 1e-77 AT1G80160 225 / 1e-76 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.003G009000 [exp] 194 / 2e-63 AT1G80160 190 / 8e-62 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.004G223300 [exp] 190 / 6e-62 AT1G80160 187 / 1e-60 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.005G117000 [exp] 187 / 6e-61 AT1G80160 166 / 2e-52 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.007G015100 [exp] 185 / 5e-60 AT1G15380 167 / 7e-53 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.009G055500 [exp] 165 / 2e-52 AT2G28420 229 / 1e-77 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1) Potri.010G087000 [exp] 50 / 4e-08 AT2G32090 189 / 3e-63 Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.018G056200 [exp] 49 / 3e-07 AT5G57040 253 / 2e-86 Lactoylglutathione lyase / glyoxalase I family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030070 [exp] 246 / 2e-84 AT1G80160 247 / 7e-85 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10014480 [exp] 243 / 3e-83 AT1G80160 244 / 1e-83 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10025971 [exp] 175 / 5e-56 AT1G15380 165 / 3e-52 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10014269 [exp] 171 / 2e-54 AT1G15380 166 / 2e-52 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10005324 [exp] 170 / 4e-54 AT2G28420 245 / 2e-83 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1) Lus10039579 [exp] 169 / 2e-53 AT2G28420 248 / 2e-84 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1) Lus10017158 [exp] 54 / 4e-09 AT5G57040 254 / 7e-87 Lactoylglutathione lyase / glyoxalase I family protein (.1) Lus10006122 [exp] 52 / 8e-09 AT2G32090 199 / 3e-67 Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10010552 [exp] 50 / 5e-08 AT2G32090 197 / 3e-66 Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10021573 [exp] 42 / 4e-05 AT5G57040 163 / 2e-51 Lactoylglutathione lyase / glyoxalase I family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0104 [poplar] [flax] Glyoxalase PF12681 [poplar] [flax] Glyoxalase_2 Glyoxalase-like domain
Representative CDS sequence Show only first row Show all	>Potri.001G171600.1 pacid=42788944 polypeptide=Potri.001G171600.1.p locus=Potri.001G171600 ID=Potri.001G171600.1.v4.1 annot-version=v4.1 ATGAAGGACCACATGGGAAACTCACTCCATCTCAAGTCTTTGAACCACATCTCACTTTTGTGTAGATCAGTTGTGGAATCCATTGATTTCTACCAGGATG TTCTTGGTTTTGTGCCAATAAGGAGGCCGGGATCTTTCAACTTTGATGGGGCATGGCTATTTGGTTTTGGAATTGGAATTCATTTATTGCAATCAGAAAA CCCAGAAAAGATGCCAAAGAAAAGTGAAATTAATCCCAAGGACAATCATATCTCGTTTCAGTGTGAGAGCATGGGAGCAGTGGAGAAGAAGCTGAAAGAA CTGGGAATTCAGCATGTGCGAGCATTAGTGGAGGAAGGTGGGATTCAGGTTGAACAGTTGTTCTTTCATGACCCTGATGGATTCATGATTGAGATTTGCA ACTGCGATAATCTCCCAGTGATCCCTCTGGCGGGCGAAGTCGCACGATCATGCTCTTGCTTGAACCTTCAAACGATGCAGCAGGAGAGGCCAATGCTCCA GCAGGGGAGAGCAATTTAG
AA sequence Show only first row Show all	>Potri.001G171600.1 pacid=42788944 polypeptide=Potri.001G171600.1.p locus=Potri.001G171600 ID=Potri.001G171600.1.v4.1 annot-version=v4.1 MKDHMGNSLHLKSLNHISLLCRSVVESIDFYQDVLGFVPIRRPGSFNFDGAWLFGFGIGIHLLQSENPEKMPKKSEINPKDNHISFQCESMGAVEKKLKE LGIQHVRALVEEGGIQVEQLFFHDPDGFMIEICNCDNLPVIPLAGEVARSCSCLNLQTMQQERPMLQQGRAI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G80160		GLYI7	glyoxylase I 7, Lactoylglutath...		Potri.001G171600 [exp]	0	1
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Potri.007G084800 [exp]	1.41	0.9278	IFS1.47,CYP736A4v1
AT5G20250		RS6, DIN10	raffinose synthase 6, DARK IND...		Potri.006G065700 [exp]	9.43	0.8710
AT1G68320	MYB	BW62C, BW62B, A...	myb domain protein 62 (.1)		Potri.008G122100 [exp]	13.60	0.9337
AT1G28480		roxy19, GRX480	Thioredoxin superfamily protei...		Potri.004G049800 [exp]	20.19	0.9059	Pt-GRX.2
AT3G57520		RS2, ATSIP2	raffinose synthase 2, seed imb...		Potri.006G052800 [exp]	20.32	0.8761
AT5G49450	bZIP	ATBZIP1	basic leucine-zipper 1 (.1)		Potri.010G142900 [exp]	21.74	0.9107
AT5G25320			ACT-like superfamily protein (...		Potri.018G025500 [exp]	23.36	0.9262
AT3G52600		ATCWINV2	cell wall invertase 2 (.1.2)		Potri.006G210600 [exp]	25.37	0.9077	BFRUCT1.1
					Potri.015G106725 [exp]	29.73	0.8956
AT3G21750		UGT71B1	UDP-glucosyl transferase 71B1 ...		Potri.016G016700 [exp]	33.46	0.8772

Compare expression of checked genes

Potri.001G171600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.