Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	2OGox10
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52790 461 / 1e-164 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G52800 346 / 2e-119 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G52820 308 / 1e-104 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G80320 285 / 2e-95 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G15540 262 / 2e-86 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G03070 261 / 3e-86 AOP1.1, AOP1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G28030 217 / 9e-69 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G52810 204 / 2e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G03050 129 / 2e-35 AOP3 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G14120 111 / 2e-28 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G176500 [exp] 377 / 7e-132 AT1G52800 338 / 1e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176200 [exp] 329 / 9e-113 AT1G52820 496 / 8e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176100 [exp] 308 / 2e-104 AT1G52800 286 / 5e-96 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G248000 [exp] 266 / 1e-87 AT1G52820 280 / 6e-93 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.018G033400 [exp] 263 / 6e-87 AT1G52820 269 / 4e-89 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G175800 [exp] 262 / 1e-86 AT1G52820 338 / 2e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G175900 [exp] 261 / 3e-86 AT1G52820 328 / 2e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.002G159500 [exp] 134 / 5e-37 AT4G23340 402 / 3e-141 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.003G128100 [exp] 119 / 5e-31 AT4G23340 458 / 2e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041281 [exp] 322 / 3e-111 AT1G52790 298 / 5e-102 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10016659 [exp] 303 / 1e-102 AT1G52820 445 / 1e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023024 [exp] 269 / 5e-89 AT1G52820 371 / 2e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005773 [exp] 220 / 7e-70 AT1G52790 205 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021025 [exp] 216 / 2e-68 AT1G52800 226 / 2e-72 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005776 [exp] 213 / 3e-67 AT1G52790 198 / 2e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10008097 [exp] 201 / 1e-62 AT1G52800 221 / 2e-70 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005516 [exp] 202 / 2e-62 AT1G52820 278 / 7e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10013132 [exp] 195 / 3e-60 AT1G52800 222 / 8e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023160 [exp] 185 / 2e-57 AT1G52820 244 / 1e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.001G176000.1 pacid=42793183 polypeptide=Potri.001G176000.1.p locus=Potri.001G176000 ID=Potri.001G176000.1.v4.1 annot-version=v4.1 ATGGGTTCCAATGAACTGCCATCAAAGCTTCCTATTCTCGACTTCGCCAAGGAAGATTTGAAGCCTGGCACAAGTTCTTGGCTCAAAGCTTGCAGTGATG TTAGGCTAGCGCTTGAAGAGTATGGCTGTTTTGTAGTAGAGTACAACAGACTACCTCTAGAACTTAGAGATAAAGTCTTTGGTGTTTTAAAGGAGTTGTT CGATCTCCCGACTGAAACAAAAATGCAGAACAAATATGAGAAGCCCTTGAATGGTTATGTTGGACAGATTGCCAAACTCCCTCTCCATGAAAGCATGGGA ATTGACAATGCAACATCTCTAGACGCAACTCAAAATTTCACAGATCTCATGTGGCCTAATGGGAATGATCGCTTCTGTGAATGTGTTCTCAAGTACGCTA ATCTAGCTGCAGAGCTAGACCGAATGGTGACCAGAATGGTATTTGAAAGTTATGGAGTAGAAAAGTACCATGACTCTTATGTTGAGTCTACTACTTACCT TCTTCGGCTTTTGAAAAATAGACCTCCCAAGGTGGACGAGCACAATTTAGGTTTTGTCACTCACACTGACAAGAGCTTCACAACCATACTTCATCAAAAT GAAATTAATGGGTTGGAAGTGGACACCAAGGATGGCAAGAAGATCAATGTTGAGCTTTCACCTTCGTCTTTTGTTGTCATAGCTGGTGATGCATTAATGG CATGGAGCAATGACAGAGTAATATCTCCTAGCCACCGTGTTATCATGAACGGAAAAATAGACAGATACTCCCTGGCGCTGTTTGCTTTCAACAAAGGAAT ATTACAAGTTCCTGAAGAACTTGTTGACGAGGAGCACCCTTTAATGTACAAGCCACTGGATCATATTGGACTCCTTCATTTCTATCGGACAGAAGAGGGA TACAAAAGCAAATGTCCTATCAAGGCTTATTGTGGCGTTTGA
AA sequence Show only first row Show all	>Potri.001G176000.1 pacid=42793183 polypeptide=Potri.001G176000.1.p locus=Potri.001G176000 ID=Potri.001G176000.1.v4.1 annot-version=v4.1 MGSNELPSKLPILDFAKEDLKPGTSSWLKACSDVRLALEEYGCFVVEYNRLPLELRDKVFGVLKELFDLPTETKMQNKYEKPLNGYVGQIAKLPLHESMG IDNATSLDATQNFTDLMWPNGNDRFCECVLKYANLAAELDRMVTRMVFESYGVEKYHDSYVESTTYLLRLLKNRPPKVDEHNLGFVTHTDKSFTTILHQN EINGLEVDTKDGKKINVELSPSSFVVIAGDALMAWSNDRVISPSHRVIMNGKIDRYSLALFAFNKGILQVPEELVDEEHPLMYKPLDHIGLLHFYRTEEG YKSKCPIKAYCGV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G52790			2-oxoglutarate (2OG) and Fe(II...		Potri.001G176000 [exp]	0	1	2OGox10
AT1G52820			2-oxoglutarate (2OG) and Fe(II...		Potri.001G175800 [exp]	1.00	0.9825
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Potri.005G030100 [exp]	2.00	0.9766	CYP76G5
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.014G152800 [exp]	2.64	0.9682
AT3G01190			Peroxidase superfamily protein...		Potri.004G023100 [exp]	3.87	0.9729
AT1G15520		ATABCG40, ABCG4...	Arabidopsis thaliana ATP-bindi...		Potri.003G178900 [exp]	5.00	0.9694
AT4G12480		PEARLI 1 1, PEA...	EARLY ARABIDOPSIS ALUMINUM IND...		Potri.013G128800 [exp]	5.74	0.9633
AT1G63440		HMA5	heavy metal atpase 5 (.1)		Potri.003G125600 [exp]	7.48	0.9582	Pt-HMA5.3
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Potri.001G002800 [exp]	7.74	0.9630	CYP716D1
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Potri.005G029800 [exp]	7.93	0.9672
AT1G05260		RCI3A, RCI3	RARE COLD INDUCIBLE GENE 3, Pe...		Potri.012G042800 [exp]	8.24	0.9705

Compare expression of checked genes

Potri.001G176000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.