Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	2OGox3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52800 286 / 5e-96 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G80320 278 / 7e-93 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G52790 274 / 3e-91 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G52820 254 / 2e-83 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G15540 244 / 3e-79 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G03070 215 / 3e-68 AOP1.1, AOP1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G28030 179 / 3e-54 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G52810 176 / 4e-53 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G03050 108 / 2e-27 AOP3 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G14130 99 / 8e-24 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G176000 [exp] 307 / 2e-104 AT1G52790 460 / 2e-164 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176500 [exp] 290 / 1e-97 AT1G52800 338 / 1e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176200 [exp] 272 / 2e-90 AT1G52820 496 / 8e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G248000 [exp] 228 / 2e-72 AT1G52820 280 / 6e-93 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.018G033400 [exp] 223 / 3e-71 AT1G52820 269 / 4e-89 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G175800 [exp] 202 / 2e-63 AT1G52820 338 / 2e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G175900 [exp] 201 / 8e-63 AT1G52820 328 / 2e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G455400 [exp] 103 / 2e-25 AT1G14130 376 / 1e-131 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G146600 [exp] 100 / 2e-24 AT1G14130 366 / 6e-128 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016659 [exp] 240 / 5e-78 AT1G52820 445 / 1e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023024 [exp] 216 / 3e-68 AT1G52820 371 / 2e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10041281 [exp] 201 / 2e-63 AT1G52790 298 / 5e-102 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005773 [exp] 191 / 8e-59 AT1G52790 205 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005776 [exp] 183 / 9e-56 AT1G52790 198 / 2e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10013132 [exp] 177 / 3e-53 AT1G52800 222 / 8e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021025 [exp] 176 / 6e-53 AT1G52800 226 / 2e-72 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10008097 [exp] 172 / 1e-51 AT1G52800 221 / 2e-70 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10013130 [exp] 169 / 2e-50 AT1G52820 200 / 3e-62 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005516 [exp] 157 / 5e-45 AT1G52820 278 / 7e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.001G176100.1 pacid=42790095 polypeptide=Potri.001G176100.1.p locus=Potri.001G176100 ID=Potri.001G176100.1.v4.1 annot-version=v4.1 ATGGGTTCTGAAACAGTATCTAAAATTCCTGTTGTTCATTTGTCCAAGGAAAACTTCGAGCCTGGCTCTAGTTCCTGGCTGGCGGCTTGCAATGATATCC GGCGAGCACTTGAGGAATACAGCTTCTTTGAAGTAGTATACAGCGAACCTTCAATGGAATTTTACAGGGAAATTATATCGGTGCTAGAGGAATTGTTCAA TCTCCCTCATGAAACAAAAAACAGAAATACACATCCTAAGCTCGGCCATGGTTACATGGGGAAAATCCCTGGCTTCCCTGAAGGCTTGGGGATCGAGTAT GCAACAAAGAAAGATGAATGTCAAAAATTTACTAGCCTTATGTGGCCCGATGGAAATGAAAGATTCTGTGATGTCATCCACTCTTTTACGAAGATAGCAT CTGAACTAAATCAGATGGTGGTAAGGATGTTGTTTGAAAGCTATGGTATAAAGAAAGATGAGCCTCTCGTAAACTCAACAAATTACCTCCTACGTCTGTT GAAATATGGAAGATCACAGGGGGAGACGAATGTTGGTTTTAAGGCTCATATGGACAAGACTTTCTTCACTCTACTTTATCAAAATCCTGTTAAAGGTTTA GAGATAAGAACCAAGGAAGGAGAGTGGATTACGTACGAGCCTTCTTCAACTACTTCATTTGCTGTCATAGCTGGTGATGTATGCATGGCATGGAGCAATG ACAGGATAAAATCGTCTTACCATCGAGTCGTTGTAAGCAGCGAAGAAGACAGATATGCACTGGGGTTATTCACATTCCTAGATGGGGTGGTACAACCACC AGAGGAGCTAGTAGATGATGAACACCCATTACAGTACAAGCCCTTTGAACACCAGAAGCTTCTTGATTTCTATCAATCATACAATGATCCAAATAAACGT GACTGCAATATCATGAAAGCCTACTGTGGTGTTTAA
AA sequence Show only first row Show all	>Potri.001G176100.1 pacid=42790095 polypeptide=Potri.001G176100.1.p locus=Potri.001G176100 ID=Potri.001G176100.1.v4.1 annot-version=v4.1 MGSETVSKIPVVHLSKENFEPGSSSWLAACNDIRRALEEYSFFEVVYSEPSMEFYREIISVLEELFNLPHETKNRNTHPKLGHGYMGKIPGFPEGLGIEY ATKKDECQKFTSLMWPDGNERFCDVIHSFTKIASELNQMVVRMLFESYGIKKDEPLVNSTNYLLRLLKYGRSQGETNVGFKAHMDKTFFTLLYQNPVKGL EIRTKEGEWITYEPSSTTSFAVIAGDVCMAWSNDRIKSSYHRVVVSSEEDRYALGLFTFLDGVVQPPEELVDDEHPLQYKPFEHQKLLDFYQSYNDPNKR DCNIMKAYCGV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G52800			2-oxoglutarate (2OG) and Fe(II...		Potri.001G176100 [exp]	0	1	2OGox3
AT2G42250		CYP712A1	"cytochrome P450, family 712, ...		Potri.006G057900 [exp]	1.00	0.9960
AT5G19890			Peroxidase superfamily protein...		Potri.003G214500 [exp]	2.23	0.9858	PRX1.10
AT5G06900		CYP93D1	"cytochrome P450, family 93, s...		Potri.006G058200 [exp]	3.46	0.9859	Pt-CYP93.2
AT1G52820			2-oxoglutarate (2OG) and Fe(II...		Potri.001G176200 [exp]	3.87	0.9866	AOP1.1
AT4G01070		UGT72B1, GT72B1	UDP-GLUCOSE-DEPENDENT GLUCOSYL...		Potri.014G041800 [exp]	4.24	0.9842
AT2G39380		ATEXO70H2	exocyst subunit exo70 family p...		Potri.008G048700 [exp]	4.58	0.9693
					Potri.013G070350 [exp]	5.19	0.9771
AT5G53190		SWEET3, AtSWEET...	Nodulin MtN3 family protein (....		Potri.015G021900 [exp]	6.78	0.9688
AT5G16010			3-oxo-5-alpha-steroid 4-dehydr...		Potri.008G012800 [exp]	7.34	0.9721
AT3G63520		ATNCED1, ATCCD1...	carotenoid cleavage dioxygenas...		Potri.006G239402 [exp]	8.48	0.9780

Compare expression of checked genes

Potri.001G176100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.