Plant FIBer expression Database

Potri.001G177333 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G52827 50 / 1e-10 ATCDT1 cadmium tolerance 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G177366
[exp]
70 / 3e-18 AT1G52827 37 / 6e-05 cadmium tolerance 1 (.1)
Flax homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF12734 CYSTM Cysteine-rich TM module stress tolerance
Representative CDS sequence
>Potri.001G177333.1 pacid=42793251 polypeptide=Potri.001G177333.1.p locus=Potri.001G177333 ID=Potri.001G177333.1.v4.1 annot-version=v4.1
ATGGATGCACCGTCACAGCAAGAGATGTCATACTATGATCACGTTAAGAGACGCCACGAGAACAAAGGCTGCCTCTATGCCTTCTTCTTCGCTCTATGTT
GCTGCTGTTGCTGCAGTGAAACTTGTGAATGCTGTGTGAAGTGTTGCTGCTGTGCTTAG
AA sequence
>Potri.001G177333.1 pacid=42793251 polypeptide=Potri.001G177333.1.p locus=Potri.001G177333 ID=Potri.001G177333.1.v4.1 annot-version=v4.1
MDAPSQQEMSYYDHVKRRHENKGCLYAFFFALCCCCCCSETCECCVKCCCCA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G52827 ATCDT1 cadmium tolerance 1 (.1) Potri.001G177333
[exp]
0 1
AT5G50690 ATHSD7 hydroxysteroid dehydrogenase 7... Potri.016G048900
[exp]
1.73 0.9848
AT1G15820 CP24, LHCB6 light harvesting complex photo... Potri.003G020400
[exp]
2.44 0.9830
AT2G14830 Regulator of Vps4 activity in ... Potri.011G122800
[exp]
3.46 0.9734
Potri.004G050600
[exp]
4.89 0.9666
AT3G15570 Phototropic-responsive NPH3 fa... Potri.003G058800
[exp]
7.74 0.9719
AT5G54270 LHCB3*1, LHCB3*... light-harvesting chlorophyll B... Potri.001G407100
[exp]
8.83 0.9706 Lhcb3-1,LHCB3.2
AT4G34530 bHLH bHLH063, CIB1 cryptochrome-interacting basic... Potri.005G121850
[exp]
9.48 0.9638
AT2G18360 alpha/beta-Hydrolases superfam... Potri.005G122600
[exp]
11.74 0.9775
AT2G06510 ATRPA70A, ATRPA... ARABIDOPSIS THALIANA RPA70-KDA... Potri.018G065300
[exp]
12.00 0.9687
AT5G53390 O-acyltransferase (WSD1-like) ... Potri.007G139501
[exp]
12.24 0.9565

Potri.001G177333 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.