Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	IAA8.3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04730 211 / 6e-69 AUX_IAA IAA16 indoleacetic acid-induced protein 16 (.1) AT1G04250 210 / 1e-68 AUX_IAA IAA17, AXR3 indole-3-acetic acid inducible 17, AUXIN RESISTANT 3, AUX/IAA transcriptional regulator family protein (.1) AT4G14550 201 / 3e-65 AUX_IAA SLR, IAA14 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) AT3G23050 197 / 1e-63 AUX_IAA AXR2, IAA7 AUXIN RESISTANT 2, indole-3-acetic acid 7 (.1.2) AT4G29080 173 / 2e-53 AUX_IAA IAA27, PAP2 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) AT1G04240 165 / 2e-51 AUX_IAA IAA3, SHY2 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) AT5G43700 163 / 8e-51 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) AT5G65670 162 / 1e-48 AUX_IAA IAA9 indole-3-acetic acid inducible 9 (.1.2) AT2G22670 160 / 7e-48 AUX_IAA IAA8 indoleacetic acid-induced protein 8 (.1.2.3.4) AT3G23030 149 / 2e-45 AUX_IAA IAA2 indole-3-acetic acid inducible 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G044900 [exp] 213 / 1e-69 AT4G14550 286 / 1e-98 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.008G161200 [exp] 212 / 2e-69 AT4G14550 343 / 1e-120 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.013G041400 [exp] 210 / 2e-68 AT3G04730 306 / 6e-106 indoleacetic acid-induced protein 16 (.1) Potri.005G053900 [exp] 202 / 3e-65 AT3G04730 317 / 3e-110 indoleacetic acid-induced protein 16 (.1) Potri.005G218300 [exp] 201 / 4e-65 AT4G14550 292 / 7e-101 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.010G078300 [exp] 197 / 9e-63 AT4G14550 319 / 1e-110 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.005G053800 [exp] 168 / 2e-52 AT5G43700 239 / 7e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.003G051300 [exp] 171 / 7e-52 AT4G29080 298 / 3e-100 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) Potri.002G108000 [exp] 170 / 2e-51 AT5G65670 355 / 4e-122 indole-3-acetic acid inducible 9 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039414 [exp] 206 / 1e-66 AT4G14550 305 / 1e-105 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Lus10015907 [exp] 203 / 3e-65 AT3G04730 309 / 5e-107 indoleacetic acid-induced protein 16 (.1) Lus10034962 [exp] 174 / 2e-53 AT4G29080 289 / 4e-97 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) Lus10012984 [exp] 169 / 2e-51 AT4G29080 280 / 8e-94 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) Lus10039413 [exp] 164 / 3e-51 AT1G04240 250 / 2e-85 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10014731 [exp] 166 / 8e-51 AT3G04730 241 / 4e-80 indoleacetic acid-induced protein 16 (.1) Lus10002723 [exp] 163 / 1e-50 AT5G43700 221 / 4e-74 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10014729 [exp] 162 / 3e-50 AT1G04240 230 / 2e-77 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10039488 [exp] 162 / 4e-50 AT5G43700 247 / 3e-84 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10019241 [exp] 164 / 8e-50 AT5G65670 356 / 4e-123 indole-3-acetic acid inducible 9 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF02309 [poplar] [flax] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Potri.001G177400.1 pacid=42791582 polypeptide=Potri.001G177400.1.p locus=Potri.001G177400 ID=Potri.001G177400.1.v4.1 annot-version=v4.1 ATGTCACCGGAAAATGGTTCAAACTTGCTGGAATCCGATGCGGCCAACGTGAGTTTCAAGGAGACAGAGTTGACCTTAGGGCTGCCTGGTGAGTCTCGTG GGCTAGCATTAATAGAGAAAACAAGTGGCAAGCGTGGGTTTTTGGAGACTGTTGATCTAAATCTTGGAAGGTCATCTAATGTTGATTCTGATCATAACAA ATATTCTGGGGAGTCCGAAACGGATGTGCCAAACACGGCTAAGCCTCCGGCAGCAAAAGCACAAGTGGTGGGGTGGCCACCGGTGAGGGCGTATAGGAAG AACGCAATGAAGAGCTGTAAATACGTAAAGGTGGCTGTAGATGGAGCTCCATATTTGAGAAAGGTTGACCTGGAGATGTACAACAGTTATCAGCAGCTCT TGAATGCCCTCCAGGACATGTTCTCTTGCTTCAGCTTCACCATCCGCAACTATTTGAATGAGAGGACAATTATGGAACAGGAAGTGAATAATGGAGTAGA GTATGTCCCTACTTATGAGGACAAGGATGGCGACTGGATGATGCTGGGGGATGTACCATGGAAAATGTTTGTTGAATCATGCAAGCGTCTACGGTTGATG AAAAGCTCAGAAGCAACTGGATTTGCTCCAAGAACACCTTCAAAATGCTCAAGCTCGAGTTGA
AA sequence Show only first row Show all	>Potri.001G177400.1 pacid=42791582 polypeptide=Potri.001G177400.1.p locus=Potri.001G177400 ID=Potri.001G177400.1.v4.1 annot-version=v4.1 MSPENGSNLLESDAANVSFKETELTLGLPGESRGLALIEKTSGKRGFLETVDLNLGRSSNVDSDHNKYSGESETDVPNTAKPPAAKAQVVGWPPVRAYRK NAMKSCKYVKVAVDGAPYLRKVDLEMYNSYQQLLNALQDMFSCFSFTIRNYLNERTIMEQEVNNGVEYVPTYEDKDGDWMMLGDVPWKMFVESCKRLRLM KSSEATGFAPRTPSKCSSSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G04730	AUX_IAA	IAA16	indoleacetic acid-induced prot...		Potri.001G177400 [exp]	0	1	IAA8.3
AT1G08250		AtADT6, ADT6	Arabidopsis thaliana arogenate...		Potri.009G148800 [exp]	1.41	0.7956
AT5G62350			Plant invertase/pectin methyle...		Potri.015G128700 [exp]	9.27	0.7326
AT2G37040		PAL1, ATPAL1	PHE ammonia lyase 1 (.1)		Potri.016G091100 [exp]	11.18	0.6890	PAL1.3,PAL4
AT5G01380	Trihelix		Homeodomain-like superfamily p...		Potri.006G101400 [exp]	13.63	0.6848
AT2G36090			F-box family protein (.1)		Potri.001G452000 [exp]	13.74	0.6754
AT3G22470			Pentatricopeptide repeat (PPR)...		Potri.016G025600 [exp]	17.66	0.6987
AT3G21550		AtDMP2	Arabidopsis thaliana DUF679 do...		Potri.010G027600 [exp]	17.88	0.6971
AT5G53460		GLT1	NADH-dependent glutamate synth...		Potri.015G017500 [exp]	20.24	0.6620	GLT1.2
AT5G48440			FAD-dependent oxidoreductase f...		Potri.014G018300 [exp]	20.49	0.6174
AT3G29200		ATCM1, CM1	ARABIDOPSIS THALIANA CHORISMAT...		Potri.017G088700 [exp]	21.54	0.6698

Compare expression of checked genes

Potri.001G177400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.