Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25735 41 / 2e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G055100 [exp] 175 / 3e-58 AT2G25735 / unknown protein Potri.018G036300 [exp] 76 / 5e-19 AT2G25735 51 / 1e-09 unknown protein Potri.006G244200 [exp] 66 / 3e-15 AT2G25735 49 / 1e-08 unknown protein Potri.007G000801 [exp] 40 / 2e-05 ND / Potri.006G259300 [exp] 39 / 0.0002 AT5G25240 47 / 2e-07 unknown protein Potri.002G257600 [exp] 37 / 0.0007 ND / Potri.004G037500 [exp] 36 / 0.0007 ND /
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007679 [exp] 46 / 1e-07 AT2G25735 53 / 1e-10 unknown protein Lus10001942 [exp] 39 / 0.0003 AT5G14890 79 / 1e-17 NHL domain-containing protein (.1) Lus10001932 [exp] 38 / 0.0005 AT5G14890 76 / 1e-17 NHL domain-containing protein (.1) Lus10001933 [exp] 38 / 0.0006 AT5G14890 78 / 4e-17 NHL domain-containing protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G180500.1 pacid=42793191 polypeptide=Potri.001G180500.1.p locus=Potri.001G180500 ID=Potri.001G180500.1.v4.1 annot-version=v4.1 ATGGAATGGTGCACTTCAGGCAGTCGAAACATGAAAAGCTACGCAGAAAGCCGGTATGATCGGATTGGGTCATTCAAGGCATTGGTCAGTGCTGAGTCGA AGACACCGAGGTGGAGATTGTTGTGGAGGAAGATGGTGAAGACAAAGAGGAAGGTTTTTGACAGTTCATCGTCGGCCCAGGTTTATCTTACCTATGATCC TTATACCTACTCTCAGAATTTCGATGATGGCTTGGTGATGTCCCACCCCGATGACAGCTCCCGGTCTTTCTCGGCTAGGTTTGCTGTCCCTTCCAGGATC TTTGAGAAGGGTGAAATGGTATGGCATGATCAAGGGCTTGCTCGTTTTACGTAG
AA sequence Show only first row Show all	>Potri.001G180500.1 pacid=42793191 polypeptide=Potri.001G180500.1.p locus=Potri.001G180500 ID=Potri.001G180500.1.v4.1 annot-version=v4.1 MEWCTSGSRNMKSYAESRYDRIGSFKALVSAESKTPRWRLLWRKMVKTKRKVFDSSSSAQVYLTYDPYTYSQNFDDGLVMSHPDDSSRSFSARFAVPSRI FEKGEMVWHDQGLARFT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G25735			unknown protein		Potri.001G180500 [exp]	0	1
AT2G21610		PE11, ATPE11	A. THALIANA PECTINESTERASE 11,...		Potri.004G156300 [exp]	5.74	0.9706
AT1G12100			Bifunctional inhibitor/lipid-t...		Potri.001G121800 [exp]	8.71	0.9700
AT5G14650			Pectin lyase-like superfamily ...		Potri.001G346800 [exp]	9.16	0.9689
AT4G13420		HAK5, ATHAK5	high affinity K+ transporter 5...		Potri.001G045200 [exp]	9.64	0.9132
AT3G10985		WI12, ATWI-12, ...	ARABIDOPSIS THALIANA WOUND-IND...		Potri.013G153801 [exp]	11.13	0.9290
AT1G64780		ATAMT1;2	ammonium transporter 1;2 (.1)		Potri.019G023600 [exp]	12.48	0.9652
AT2G01900			DNAse I-like superfamily prote...		Potri.010G101700 [exp]	15.00	0.9637
AT3G53480		PIS1, ABCG37, P...	polar auxin transport inhibito...		Potri.015G006000 [exp]	16.24	0.9578
AT2G28160	bHLH	ATFIT1, ATBHLH2...	ARABIDOPSIS FE-DEFICIENCY INDU...		Potri.009G005600 [exp]	19.44	0.9565
AT5G15180			Peroxidase superfamily protein...		Potri.007G122250 [exp]	19.79	0.9567

Compare expression of checked genes

Potri.001G180500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.