Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29280 54 / 4e-11 LCR22 low-molecular-weight cysteine-rich 22 (.1) AT4G29283 53 / 1e-10 LCR21 low-molecular-weight cysteine-rich 21 (.1) AT4G29305 49 / 4e-09 LCR25 low-molecular-weight cysteine-rich 25 (.1) AT4G29273 47 / 2e-08 LCR23 low-molecular-weight cysteine-rich 23 (.1) AT4G29300 45 / 1e-07 LCR27 low-molecular-weight cysteine-rich 27 (.1) AT4G29290 45 / 1e-07 LCR26 low-molecular-weight cysteine-rich 26 (.1) AT3G43505 43 / 7e-07 LCR30 low-molecular-weight cysteine-rich 30 (.1) AT4G09153 42 / 9e-07 LCR36 low-molecular-weight cysteine-rich 36 (.1) AT4G29285 42 / 1e-06 LCR24 low-molecular-weight cysteine-rich 24 (.1) AT2G22121 42 / 2e-06 LCR35 low-molecular-weight cysteine-rich 35 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G195532 [exp] 82 / 2e-22 AT4G29280 46 / 5e-08 low-molecular-weight cysteine-rich 22 (.1) Potri.001G401800 [exp] 39 / 2e-05 AT4G09153 43 / 5e-07 low-molecular-weight cysteine-rich 36 (.1) Potri.006G165250 [exp] 37 / 0.0001 ND /
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015984 [exp] 87 / 2e-24 AT4G29280 47 / 1e-08 low-molecular-weight cysteine-rich 22 (.1) Lus10015983 [exp] 51 / 5e-10 AT4G29280 41 / 3e-06 low-molecular-weight cysteine-rich 22 (.1) Lus10025663 [exp] 47 / 2e-08 AT4G29283 44 / 2e-07 low-molecular-weight cysteine-rich 21 (.1) Lus10014355 [exp] 37 / 0.0001 AT2G25344 49 / 2e-09 low-molecular-weight cysteine-rich 14 (.1) Lus10017432 [exp] 37 / 0.0002 AT4G29305 39 / 3e-05 low-molecular-weight cysteine-rich 25 (.1) Lus10014354 [exp] 35 / 0.0006 AT2G25344 49 / 3e-09 low-molecular-weight cysteine-rich 14 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0054 [poplar] [flax] Knottin_1 PF07333 [poplar] [flax] SLR1-BP S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP)
Representative CDS sequence Show only first row Show all	>Potri.001G180750.1 pacid=42787798 polypeptide=Potri.001G180750.1.p locus=Potri.001G180750 ID=Potri.001G180750.1.v4.1 annot-version=v4.1 ATGGCTAGAATTTCATTCACTCGTTTTTTTACCCTTTTTCTCGTTCTCTCAGCTGCATTGGTGACACCTCATGTGAATGGAGCAAAGAGATGTCTGGATA TTTTGTACAAAAGTGGATGTAATCTCGAGGATTGCGGCGCAAAATGCTACAAGAAACACAATTCAATTCATGGAGGACAATGCATCGCCAATCCTACTAT GACTGATTACTCTTGTGTTTGTGCTTATAATTGTGATGGTTAG
AA sequence Show only first row Show all	>Potri.001G180750.1 pacid=42787798 polypeptide=Potri.001G180750.1.p locus=Potri.001G180750 ID=Potri.001G180750.1.v4.1 annot-version=v4.1 MARISFTRFFTLFLVLSAALVTPHVNGAKRCLDILYKSGCNLEDCGAKCYKKHNSIHGGQCIANPTMTDYSCVCAYNCDG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G29280		LCR22	low-molecular-weight cysteine-...		Potri.001G180750 [exp]	0	1

Compare expression of checked genes

Potri.001G180750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.