Potri.001G181601 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G145950 49 / 7e-08 AT4G12560 113 / 7e-28 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.001G181601.1 pacid=42788260 polypeptide=Potri.001G181601.1.p locus=Potri.001G181601 ID=Potri.001G181601.1.v4.1 annot-version=v4.1
ATGATATGGTGTTGGAGGTGTTACTTGATGACTACGCTGATTATTTTGTTGAGAGTCTCGCTTTACTTGATAGATCAAACTAGACTCGGTAGCAAAAGGC
TGCTGGACCTGCAACAACTAGTGGAGCTTAGTAAAAGAACAAAAGAGGCACTTGAGAGGTTATATTTGAAAAGGAAAACAGTATTCTATAAAAGACATCA
GTTTTATATGTTAATGTTTCTTAACATTTACTTGTTCTTGGAGGTTTCTGGGCATCAACATATGAAACTATTCTATAATTTTGGCAAATTCTGA
AA sequence
>Potri.001G181601.1 pacid=42788260 polypeptide=Potri.001G181601.1.p locus=Potri.001G181601 ID=Potri.001G181601.1.v4.1 annot-version=v4.1
MIWCWRCYLMTTLIILLRVSLYLIDQTRLGSKRLLDLQQLVELSKRTKEALERLYLKRKTVFYKRHQFYMLMFLNIYLFLEVSGHQHMKLFYNFGKF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G181601 0 1
AT5G47540 Mo25 family protein (.1) Potri.002G222800 11.09 0.8935
AT2G21870 MGP1 MALE GAMETOPHYTE DEFECTIVE 1, ... Potri.005G085500 21.09 0.8896
AT4G26270 PFK3 phosphofructokinase 3 (.1) Potri.006G235066 22.49 0.8013
AT5G04700 Ankyrin repeat family protein ... Potri.008G023101 23.62 0.8852
AT1G17170 ATGSTU24 Arabidopsis thaliana Glutathio... Potri.001G436433 24.81 0.8828
AT1G30800 Fasciclin-like arabinogalactan... Potri.011G155150 37.34 0.8517
AT2G32580 Protein of unknown function (D... Potri.004G006500 39.77 0.8665
AT5G11600 unknown protein Potri.018G043800 40.39 0.8230
AT3G19090 RNA-binding protein (.1) Potri.009G106500 44.27 0.8595
AT5G02280 SNARE-like superfamily protein... Potri.009G069800 45.56 0.8680

Potri.001G181601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.