Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G16100 394 / 5e-142 AtRABG3c, AtRab7D RAB GTPase homolog G3C (.1) AT1G52280 392 / 3e-141 AtRABG3d RAB GTPase homolog G3D (.1) AT3G18820 377 / 3e-135 RAB71, AtRABG3f, AtRab7B RAB GTPase homolog G3F (.1) AT1G49300 364 / 4e-130 ATRAB7, ATRABG3E ARABIDOPSIS RAB GTPASE HOMOLOG G3E, ARABIDOPSIS RAB GTPASE HOMOLOG 7, RAB GTPase homolog G3E (.1.2) AT1G22740 312 / 1e-109 RAB75, RAB7, AtRABG3b RAB GTPase homolog G3B (.1) AT4G09720 310 / 2e-108 AtRABG3a RAB GTPase homolog G3A (.1.2.3.4) AT2G21880 278 / 8e-96 AtRab7A, AtRABG2 ARABIDOPSIS RAB GTPASE HOMOLOG G2, RAB GTPase homolog 7A (.1.2) AT5G39620 211 / 8e-70 AtRABG1 RAB GTPase homolog G1 (.1) AT2G44610 136 / 2e-40 RAB6, AtRABH1b, AtRab6A Ras-related small GTP-binding family protein (.1) AT1G28550 131 / 3e-38 AtRABA1i RAB GTPase homolog A1I (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G053400 [exp] 423 / 3e-153 AT1G52280 395 / 2e-142 RAB GTPase homolog G3D (.1) Potri.009G115000 [exp] 383 / 2e-137 AT3G18820 408 / 2e-147 RAB GTPase homolog G3F (.1) Potri.004G153400 [exp] 381 / 7e-137 AT3G18820 405 / 2e-146 RAB GTPase homolog G3F (.1) Potri.002G062400 [exp] 325 / 2e-114 AT4G09720 375 / 1e-134 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G198800 [exp] 308 / 4e-108 AT4G09720 370 / 2e-132 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G085300 [exp] 285 / 7e-99 AT4G09720 291 / 3e-101 RAB GTPase homolog G3A (.1.2.3.4) Potri.007G079700 [exp] 231 / 6e-78 AT4G09720 272 / 3e-94 RAB GTPase homolog G3A (.1.2.3.4) Potri.002G135500 [exp] 135 / 7e-40 AT2G44610 385 / 3e-138 Ras-related small GTP-binding family protein (.1) Potri.001G080400 [exp] 135 / 1e-39 AT1G02130 387 / 2e-139 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035872 [exp] 407 / 8e-147 AT1G52280 397 / 4e-143 RAB GTPase homolog G3D (.1) Lus10040468 [exp] 376 / 1e-134 AT3G18820 403 / 2e-145 RAB GTPase homolog G3F (.1) Lus10042328 [exp] 341 / 1e-120 AT3G18820 367 / 3e-131 RAB GTPase homolog G3F (.1) Lus10023582 [exp] 313 / 5e-110 AT3G18820 330 / 4e-117 RAB GTPase homolog G3F (.1) Lus10028719 [exp] 293 / 5e-102 AT4G09720 341 / 5e-121 RAB GTPase homolog G3A (.1.2.3.4) Lus10006059 [exp] 279 / 1e-96 AT4G09720 323 / 4e-114 RAB GTPase homolog G3A (.1.2.3.4) Lus10025790 [exp] 266 / 1e-91 AT1G52280 257 / 5e-88 RAB GTPase homolog G3D (.1) Lus10043349 [exp] 133 / 6e-39 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1) Lus10019501 [exp] 133 / 6e-39 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1) Lus10005890 [exp] 129 / 4e-37 AT3G46060 396 / 2e-142 RAB GTPase homolog 8A (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.001G182900.1 pacid=42788816 polypeptide=Potri.001G182900.1.p locus=Potri.001G182900 ID=Potri.001G182900.1.v4.1 annot-version=v4.1 ATGGCTACTCGTAGACGCATGCTCTTGAAGGTTATAATTCTCGGTGACAGCGGGGTAGGCAAGACATCACTAATGAATCAGTATGTGAATCGAAAGTTCA GTAATCAATACAAGGCGACGATAGGAGCTGACTTCTTAACCAAAGAAGTCCATTTTGAGGATAGATTGTTCACATTGCAGATATGGGATACTGCAGGACA AGAGAGGTTTCAAAGTCTTGGAGTGGCTTTCTACCGTGGTGCAGACTGTTGTGTTCTTGTGCATGATGTGAATGTCATGAAGTCATTTGAGAATCTTAAT AATTGGCGAGAAGAGTTTCTGATTCAGGCTAGCCCATCCGACCCTGAAAACTTCCCATTTGTTGTGTTGGGGAACAAGATAGATGTTGATGGAGGCAATA GTCGAGTGGTTTCTGAGAAGAAAGCGAAGGCATGGTGCGCTGCTAAGGGAAACATACCTTACTTTGAGACTTCCGCAAAAGAAGGCTTCAATGTGGACGC TGCATTTCAGTGCATAGCCAAAAATGCGCTTAAGAATGAACCTGAAGAAGAAATATACCTTCCTGACACCATTGATGTTGCGGGTGGAGGGCGACAACAA ACGTCCACCGGGTGCGAATGTTGA
AA sequence Show only first row Show all	>Potri.001G182900.1 pacid=42788816 polypeptide=Potri.001G182900.1.p locus=Potri.001G182900 ID=Potri.001G182900.1.v4.1 annot-version=v4.1 MATRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVHFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVHDVNVMKSFENLN NWREEFLIQASPSDPENFPFVVLGNKIDVDGGNSRVVSEKKAKAWCAAKGNIPYFETSAKEGFNVDAAFQCIAKNALKNEPEEEIYLPDTIDVAGGGRQQ TSTGCEC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G16100		AtRABG3c, AtRab...	RAB GTPase homolog G3C (.1)		Potri.001G182900 [exp]	0	1
AT1G23800		ALDH2B7	aldehyde dehydrogenase 2B7 (.1...		Potri.002G189900 [exp]	45.71	0.5991	ALDH2.1
AT3G58750		CSY2	citrate synthase 2 (.1)		Potri.016G089300 [exp]	61.38	0.5836
AT5G16820	HSF	ATHSF3, ATHSFA1...	ARABIDOPSIS THALIANA CLASS A H...		Potri.011G051600 [exp]	67.82	0.6322
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Potri.006G023101 [exp]	70.71	0.6545
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Potri.006G022300 [exp]	72.12	0.6615
AT5G05340			Peroxidase superfamily protein...		Potri.013G156500 [exp]	80.69	0.6562	Pt-PRX1.15
AT1G20225			Thioredoxin superfamily protei...		Potri.002G017500 [exp]	88.17	0.6495
AT4G05070			Wound-responsive family protei...		Potri.011G041700 [exp]	88.62	0.6068
AT2G24860			DnaJ/Hsp40 cysteine-rich domai...		Potri.006G266800 [exp]	110.23	0.6285
					Potri.001G388900 [exp]	111.49	0.6285

Compare expression of checked genes

Potri.001G182900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.