Potri.001G185200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G19950 65 / 3e-12 RING/U-box superfamily protein (.1)
AT3G02340 65 / 3e-12 RING/U-box superfamily protein (.1)
AT5G08139 64 / 7e-12 RING/U-box superfamily protein (.1)
AT3G15740 63 / 7e-12 RING/U-box superfamily protein (.1)
AT5G64920 64 / 9e-12 CIP8 COP1-interacting protein 8 (.1)
AT3G13430 62 / 2e-11 RING/U-box superfamily protein (.1.2.3)
AT1G60360 61 / 7e-11 RING/U-box superfamily protein (.1)
AT3G60080 61 / 8e-11 RING/U-box superfamily protein (.1)
AT4G05350 60 / 9e-11 RING/U-box superfamily protein (.1)
AT3G10815 59 / 9e-11 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G107000 80 / 4e-18 AT1G18760 79 / 7e-18 Zinc finger, C3HC4 type (RING finger) family protein (.1)
Potri.007G118000 79 / 8e-18 AT1G18760 81 / 1e-18 Zinc finger, C3HC4 type (RING finger) family protein (.1)
Potri.005G062400 77 / 4e-17 AT1G60360 82 / 3e-18 RING/U-box superfamily protein (.1)
Potri.001G103900 74 / 4e-16 AT4G26400 85 / 2e-19 RING/U-box superfamily protein (.1.2)
Potri.002G083001 71 / 6e-15 AT1G18760 81 / 1e-18 Zinc finger, C3HC4 type (RING finger) family protein (.1)
Potri.001G231000 67 / 1e-13 AT3G60080 100 / 3e-25 RING/U-box superfamily protein (.1)
Potri.012G036700 68 / 3e-13 AT3G19950 273 / 5e-90 RING/U-box superfamily protein (.1)
Potri.015G028400 65 / 3e-12 AT3G19950 256 / 2e-83 RING/U-box superfamily protein (.1)
Potri.004G122000 62 / 6e-12 AT1G26800 94 / 1e-24 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018167 76 / 2e-16 AT3G19950 75 / 1e-15 RING/U-box superfamily protein (.1)
Lus10025671 71 / 2e-14 AT3G13228 74 / 4e-15 RING/U-box superfamily protein (.1)
Lus10030755 66 / 1e-12 AT2G40830 336 / 2e-115 RING-H2 finger C1A (.1.2.3)
Lus10010179 66 / 2e-12 AT3G19950 285 / 6e-96 RING/U-box superfamily protein (.1)
Lus10013235 65 / 5e-12 AT2G40830 334 / 7e-115 RING-H2 finger C1A (.1.2.3)
Lus10020258 64 / 2e-11 AT1G19800 469 / 4e-161 ATP-binding cassette I14, trigalactosyldiacylglycerol 1 (.1.2.3)
Lus10013397 63 / 2e-11 AT5G56340 330 / 5e-111 RING/U-box superfamily protein (.1)
Lus10023235 63 / 2e-11 AT5G08139 194 / 7e-58 RING/U-box superfamily protein (.1)
Lus10031422 62 / 2e-11 AT5G64920 210 / 5e-66 COP1-interacting protein 8 (.1)
Lus10008874 62 / 4e-11 AT5G08139 198 / 3e-59 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.001G185200.1 pacid=42790761 polypeptide=Potri.001G185200.1.p locus=Potri.001G185200 ID=Potri.001G185200.1.v4.1 annot-version=v4.1
ATGTCAGACTTTGGTGACTTATGCTTTTCTACTATTCCACTGGATTTAGTTAAACCAGGAGATGATTCTGTGCTGTGTAACAAGTTCTGCATTGTGGTTG
AAGCAAGTTTCATGCCTCCTGTACCTTTTGATGAAGACGATCTTCAAGATGATGAATCACAGCATCTCTACGATGCGGACTGCGATTGGGTGAAGAGAGA
TTTCCTGGTTGATCGTGACCAGTTATTGCATGACCTAGAAACTTCAAGATTAACCATCCGCAATATCCTTACTGTTATGGATATCCCCGTTAGGGCTTTC
ATGATAGATCAGGTATTGACTTGTGCTCGTCAGATGGCAAGAAGTGTCCTGCTCTTGGATCGTAAGGTTTTGTATATGAAGGTGAGAGTTGATGTCCCGC
CAAGTTTTGATGAGTCTTCGGGCGGCGGCAGCGACGACGAAGATGATGATGATGATGTCTTAAGCTTTGTGCCTGCCACCGCATCGTCTATAGAGAAATT
GGAGATTGTGAAGGTTGAATTAGAAGGGTCTGCTAACCAGCCATGCGCAGTTTGTTTCGACCAACTTTTGGTTGGCTGTGAAGCAACTCGATTGCCTTGC
TCACATGTCTATCATTGCGGGTGCATACGCAGATGGTTGGAGAAGAGCAAATTCTGTCCGCTCTGTAGGTTTGAAGTTTCTTAA
AA sequence
>Potri.001G185200.1 pacid=42790761 polypeptide=Potri.001G185200.1.p locus=Potri.001G185200 ID=Potri.001G185200.1.v4.1 annot-version=v4.1
MSDFGDLCFSTIPLDLVKPGDDSVLCNKFCIVVEASFMPPVPFDEDDLQDDESQHLYDADCDWVKRDFLVDRDQLLHDLETSRLTIRNILTVMDIPVRAF
MIDQVLTCARQMARSVLLLDRKVLYMKVRVDVPPSFDESSGGGSDDEDDDDDVLSFVPATASSIEKLEIVKVELEGSANQPCAVCFDQLLVGCEATRLPC
SHVYHCGCIRRWLEKSKFCPLCRFEVS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G02340 RING/U-box superfamily protein... Potri.001G185200 0 1
AT1G76060 EMB1793 EMBRYO DEFECTIVE 1793, LYR fam... Potri.002G016600 14.69 0.8153 Pt-EMB1793.1
ATCG00540 ATCG00540.1, PE... photosynthetic electron transf... Potri.013G162200 19.49 0.8130
Potri.002G088800 21.97 0.8824
Potri.014G121801 22.27 0.8587
AT5G54680 bHLH bHLH105, ILR3 iaa-leucine resistant3, basic ... Potri.011G132400 25.49 0.8030
Potri.017G015134 25.69 0.7854
Potri.005G124601 27.34 0.8576
AT1G49950 MYB ATTRB1, TRB1 telomere repeat binding factor... Potri.009G087000 28.49 0.8318 SMH901
AT3G21330 bHLH bHLH087 basic helix-loop-helix (bHLH) ... Potri.017G041000 36.00 0.8573
AT3G19184 B3 AP2/B3-like transcriptional fa... Potri.004G141800 36.46 0.7829

Potri.001G185200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.